BLASTX nr result
ID: Catharanthus22_contig00019578
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00019578 (720 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535142.1| conserved hypothetical protein [Ricinus comm... 71 3e-17 >ref|XP_002535142.1| conserved hypothetical protein [Ricinus communis] gi|223523947|gb|EEF27248.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 70.9 bits (172), Expect(2) = 3e-17 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 298 VIYLDQFLEALEIQTGSENHWRLWRPSFRQQRSHP 194 VIYLDQF EALEIQTGSENHWRL RPSFRQQRSHP Sbjct: 32 VIYLDQFPEALEIQTGSENHWRLRRPSFRQQRSHP 66 Score = 44.3 bits (103), Expect(2) = 3e-17 Identities = 20/26 (76%), Positives = 20/26 (76%) Frame = -2 Query: 389 RGLVLYFRAGREVKAIREDCPPGKEE 312 RG YF REVKAIREDCPPGKEE Sbjct: 4 RGAGFYFLTEREVKAIREDCPPGKEE 29