BLASTX nr result
ID: Catharanthus22_contig00019404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00019404 (257 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004245491.1| PREDICTED: protein ABIL2-like [Solanum lycop... 55 9e-06 >ref|XP_004245491.1| PREDICTED: protein ABIL2-like [Solanum lycopersicum] Length = 333 Score = 55.1 bits (131), Expect = 9e-06 Identities = 29/59 (49%), Positives = 40/59 (67%) Frame = -1 Query: 179 TVTKQRKGHSRMHATEVPIRPLTFSFMRLASSKEGGKRAVSPLSFSLGRSGSVAHRSIS 3 ++ K K HS+ T+ PL FSF R+ S+KE GKR++SPL F + RSGSV +RS+S Sbjct: 192 SIPKYMKKHSKNSWTDASPNPLNFSFTRVPSNKEVGKRSISPLKFGVKRSGSV-NRSVS 249