BLASTX nr result
ID: Catharanthus22_contig00019144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00019144 (206 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004243124.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-10 ref|XP_006443350.1| hypothetical protein CICLE_v10019425mg [Citr... 69 5e-10 gb|EOY10733.1| Pentatricopeptide repeat-containing protein, puta... 68 1e-09 ref|XP_002275952.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|NP_197005.2| pentatricopeptide repeat-containing protein [Ar... 67 3e-09 ref|XP_002525469.1| pentatricopeptide repeat-containing protein,... 67 3e-09 emb|CAC01820.1| putative protein [Arabidopsis thaliana] 67 3e-09 ref|XP_006286634.1| hypothetical protein CARUB_v10002473mg [Caps... 66 4e-09 ref|XP_006352063.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 ref|XP_002871645.1| pentatricopeptide repeat-containing protein ... 65 7e-09 ref|XP_002319140.2| pentatricopeptide repeat-containing family p... 65 9e-09 ref|XP_002319139.1| predicted protein [Populus trichocarpa] 65 9e-09 gb|EPS59675.1| hypothetical protein M569_15124, partial [Genlise... 65 1e-08 gb|EMT31806.1| hypothetical protein F775_12996 [Aegilops tauschii] 65 1e-08 gb|EMS67682.1| hypothetical protein TRIUR3_04331 [Triticum urartu] 65 1e-08 ref|XP_006644900.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006387693.1| hypothetical protein POPTR_0671s00210g [Popu... 64 2e-08 ref|XP_003624580.1| Pentatricopeptide repeat-containing protein ... 63 5e-08 gb|ESW33763.1| hypothetical protein PHAVU_001G0968000g, partial ... 62 6e-08 gb|ESW33762.1| hypothetical protein PHAVU_001G0968000g [Phaseolu... 62 6e-08 >ref|XP_004243124.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Solanum lycopersicum] Length = 548 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = +3 Query: 51 RNLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 R++MK MEE+ ++P+ VTYNSLIMPLC+ R P EA+E+F EMI RG+ PT R Sbjct: 334 RSVMKMMEENDLAPNAVTYNSLIMPLCKARLPDEAQEIFNEMIQRGIHPTVR 385 >ref|XP_006443350.1| hypothetical protein CICLE_v10019425mg [Citrus clementina] gi|568850720|ref|XP_006479049.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Citrus sinensis] gi|557545612|gb|ESR56590.1| hypothetical protein CICLE_v10019425mg [Citrus clementina] Length = 588 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +3 Query: 54 NLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 +LMK MEE G++P+VVTYNSLI PLC+ R+ EAR+ F EM+ RG+SPT R Sbjct: 371 SLMKSMEEKGVAPNVVTYNSLIKPLCKARKLDEARQAFDEMLQRGISPTIR 421 >gb|EOY10733.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 602 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +3 Query: 54 NLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 NL+K MEE GI+P+VVTYNSLI PLC+ ++ EAR+VF EM+ R +SPT R Sbjct: 377 NLLKTMEEKGIAPNVVTYNSLIKPLCKAQKIDEARQVFDEMLQRDLSPTIR 427 >ref|XP_002275952.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Vitis vinifera] Length = 566 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +3 Query: 54 NLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 NLMK ME GI+PD VTYNSLI PL R R+ EA+EVF EM+ RG+SPT R Sbjct: 346 NLMKAMEGKGIAPDSVTYNSLIKPLSRARKINEAKEVFDEMLQRGLSPTIR 396 >ref|NP_197005.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|223635761|sp|Q9LFQ4.2|PP383_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g15010, mitochondrial; Flags: Precursor gi|332004721|gb|AED92104.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 572 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +3 Query: 51 RNLMKKMEES-GISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 RNLMK MEE GI P+VVTYNSLI PLC+ R+ EA++VF EM+ +G+ PT R Sbjct: 357 RNLMKTMEEEKGIEPNVVTYNSLIKPLCKARKTEEAKQVFDEMLEKGLFPTIR 409 >ref|XP_002525469.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535282|gb|EEF36959.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 581 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 54 NLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 NLMK MEE GI+P+ VTYNSLI PLCR R+ EAR +F EM+ G SPT R Sbjct: 360 NLMKTMEEKGIAPNTVTYNSLIKPLCRARKIDEARGLFDEMLQHGHSPTIR 410 >emb|CAC01820.1| putative protein [Arabidopsis thaliana] Length = 532 Score = 66.6 bits (161), Expect = 3e-09 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +3 Query: 51 RNLMKKMEES-GISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 RNLMK MEE GI P+VVTYNSLI PLC+ R+ EA++VF EM+ +G+ PT R Sbjct: 317 RNLMKTMEEEKGIEPNVVTYNSLIKPLCKARKTEEAKQVFDEMLEKGLFPTIR 369 >ref|XP_006286634.1| hypothetical protein CARUB_v10002473mg [Capsella rubella] gi|482555340|gb|EOA19532.1| hypothetical protein CARUB_v10002473mg [Capsella rubella] Length = 580 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +3 Query: 51 RNLMKKMEES-GISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 RNLMK MEE GI P+VVTYNS+I PLC+ R+ EA++VF EM+ +G+ PT R Sbjct: 362 RNLMKTMEEEKGIKPNVVTYNSIIKPLCKARKTEEAKQVFDEMLGKGLFPTIR 414 >ref|XP_006352063.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Solanum tuberosum] Length = 566 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = +3 Query: 51 RNLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 R++MK MEE+ ++P+ VTYNSLIMPLC+ + EA+E+F EMI RG+ PT R Sbjct: 352 RSVMKMMEENDLAPNAVTYNSLIMPLCKAQLLDEAQEIFNEMIQRGIHPTVR 403 >ref|XP_002871645.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317482|gb|EFH47904.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 524 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 1/53 (1%) Frame = +3 Query: 51 RNLMKKMEES-GISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 RNLMK MEE G+ P+VVTYNSLI PLC+ R+ EA++VF EM+ +G+ PT R Sbjct: 306 RNLMKTMEEEKGMEPNVVTYNSLIKPLCKARKTEEAKQVFDEMLEKGLFPTIR 358 >ref|XP_002319140.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550324994|gb|EEE95063.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 518 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = +3 Query: 54 NLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 NLMK MEE G++P++VTYNSLI PLCR R+ EA+ F +M+ R +SPT R Sbjct: 288 NLMKTMEEKGVAPNIVTYNSLIKPLCRARKVEEAKGAFDDMLKRCISPTIR 338 >ref|XP_002319139.1| predicted protein [Populus trichocarpa] Length = 518 Score = 65.1 bits (157), Expect = 9e-09 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = +3 Query: 54 NLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 NLMK MEE G++P++VTYNSLI PLCR R+ EA+ F +M+ R +SPT R Sbjct: 288 NLMKTMEEKGVAPNIVTYNSLIKPLCRARKVEEAKGAFDDMLKRCISPTIR 338 >gb|EPS59675.1| hypothetical protein M569_15124, partial [Genlisea aurea] Length = 426 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = +3 Query: 54 NLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 +LMK MEE GI PD VTYNSLIMPLC+ R EA++ F EM+ RG+ P+ R Sbjct: 261 SLMKTMEEKGIPPDSVTYNSLIMPLCKHRLLDEAKQAFDEMMQRGLLPSVR 311 >gb|EMT31806.1| hypothetical protein F775_12996 [Aegilops tauschii] Length = 371 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = +3 Query: 51 RNLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 R L++ MEE G++PD TYNSLI PLC+ RQ EARE+F EM+ RG+ + R Sbjct: 79 RALVRSMEEKGVTPDTATYNSLIRPLCKARQVQEAREMFDEMVGRGLLASVR 130 >gb|EMS67682.1| hypothetical protein TRIUR3_04331 [Triticum urartu] Length = 359 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = +3 Query: 51 RNLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 R L++ MEE G++PD TYNSLI PLC+ RQ EARE+F EM+ RG+ + R Sbjct: 169 RALVRSMEEKGVAPDTATYNSLIRPLCKARQVQEAREMFDEMVGRGLLASVR 220 >ref|XP_006644900.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15010, mitochondrial-like [Oryza brachyantha] Length = 526 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/52 (51%), Positives = 39/52 (75%) Frame = +3 Query: 51 RNLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 + L++ MEE G++PD T+NSLI PLC+ RQ EARE+ +M+ RG+SP+ R Sbjct: 337 KTLVRSMEEKGVAPDTATFNSLIRPLCKARQIQEAREMLDDMLGRGLSPSVR 388 >ref|XP_006387693.1| hypothetical protein POPTR_0671s00210g [Populus trichocarpa] gi|550308165|gb|ERP46607.1| hypothetical protein POPTR_0671s00210g [Populus trichocarpa] Length = 599 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/51 (56%), Positives = 39/51 (76%) Frame = +3 Query: 54 NLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 NLM+ MEE G++P++VTYNSLI PLCR R+ EA+ F +M+ R +SPT R Sbjct: 369 NLMRTMEEKGVAPNIVTYNSLIKPLCRARKVEEAKGAFDDMLKRCISPTIR 419 >ref|XP_003624580.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355499595|gb|AES80798.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 585 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/51 (52%), Positives = 40/51 (78%) Frame = +3 Query: 54 NLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPTAR 206 NL+ KME++ ++PD +TYNSLI PLC+ R+ EA+E+F M+ RG+SP+ R Sbjct: 364 NLIIKMEDNNVTPDAITYNSLIKPLCKARKIDEAKEIFNVMLERGISPSIR 414 >gb|ESW33763.1| hypothetical protein PHAVU_001G0968000g, partial [Phaseolus vulgaris] Length = 617 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/49 (57%), Positives = 40/49 (81%) Frame = +3 Query: 54 NLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPT 200 NL++KME++ I P+VVTYNSLI PLC+ R+ EA+++F EM+ R +SPT Sbjct: 391 NLIEKMEDNNIIPNVVTYNSLIKPLCKARKVDEAKQLFDEMLERSLSPT 439 >gb|ESW33762.1| hypothetical protein PHAVU_001G0968000g [Phaseolus vulgaris] Length = 611 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/49 (57%), Positives = 40/49 (81%) Frame = +3 Query: 54 NLMKKMEESGISPDVVTYNSLIMPLCRKRQPVEAREVFYEMIARGMSPT 200 NL++KME++ I P+VVTYNSLI PLC+ R+ EA+++F EM+ R +SPT Sbjct: 391 NLIEKMEDNNIIPNVVTYNSLIKPLCKARKVDEAKQLFDEMLERSLSPT 439