BLASTX nr result
ID: Catharanthus22_contig00019075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00019075 (1866 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citr... 62 9e-07 >ref|XP_006421013.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] gi|557522886|gb|ESR34253.1| hypothetical protein CICLE_v10006377mg [Citrus clementina] Length = 71 Score = 62.0 bits (149), Expect = 9e-07 Identities = 34/60 (56%), Positives = 37/60 (61%) Frame = +3 Query: 501 YPGGGNGKQRDIA*NLSKSKTRTFEKTIHFY*FPKPVFQ*GNGPATVLLSMHHDTTTFIS 680 YPGGGNGKQRDIA N K F+K FP +FQ N P T+LLSMHH TFIS Sbjct: 7 YPGGGNGKQRDIAQNAGIQKANIFDKRKSLNYFPVALFQERNEPVTMLLSMHH-VPTFIS 65