BLASTX nr result
ID: Catharanthus22_contig00018990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00018990 (210 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591130.1| DNA (cytosine-5)-methyltransferase 3B [Medic... 52 4e-06 gb|AAD24567.1|AF120335_1 putative transposase [Arabidopsis thali... 55 7e-06 gb|AAF19546.1|AC007190_14 F23N19.13 [Arabidopsis thaliana] 55 7e-06 gb|AAF79835.1|AC026875_15 T6D22.19 [Arabidopsis thaliana] 55 7e-06 >ref|XP_003591130.1| DNA (cytosine-5)-methyltransferase 3B [Medicago truncatula] gi|355480178|gb|AES61381.1| DNA (cytosine-5)-methyltransferase 3B [Medicago truncatula] Length = 722 Score = 52.0 bits (123), Expect(2) = 4e-06 Identities = 20/37 (54%), Positives = 32/37 (86%) Frame = -3 Query: 208 YFHVRCNSHILNMIVRNGLKAISAPIYKVRESVEYVR 98 +FH+RC++HILN+IV++ LK +S ++K+R+SV YVR Sbjct: 479 FFHIRCSTHILNLIVQDRLKVVSDALHKIRQSVAYVR 515 Score = 24.3 bits (51), Expect(2) = 4e-06 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 98 RPQSRQLKFVECVRH 54 R QSR L+F ECVR+ Sbjct: 515 REQSRTLQFFECVRN 529 >gb|AAD24567.1|AF120335_1 putative transposase [Arabidopsis thaliana] Length = 577 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/38 (57%), Positives = 34/38 (89%) Frame = -3 Query: 208 YFHVRCNSHILNMIVRNGLKAISAPIYKVRESVEYVRG 95 +FHVRC++HILN+IV++GL+ IS + K+RE+V+YV+G Sbjct: 192 FFHVRCSAHILNLIVQDGLEVISGALEKIRETVKYVKG 229 >gb|AAF19546.1|AC007190_14 F23N19.13 [Arabidopsis thaliana] Length = 633 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/38 (57%), Positives = 34/38 (89%) Frame = -3 Query: 208 YFHVRCNSHILNMIVRNGLKAISAPIYKVRESVEYVRG 95 +FHVRC++HILN+IV++GL+ IS + K+RE+V+YV+G Sbjct: 285 FFHVRCSAHILNLIVQDGLEVISGALEKIRETVKYVKG 322 >gb|AAF79835.1|AC026875_15 T6D22.19 [Arabidopsis thaliana] Length = 745 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/38 (57%), Positives = 34/38 (89%) Frame = -3 Query: 208 YFHVRCNSHILNMIVRNGLKAISAPIYKVRESVEYVRG 95 +FHVRC++HILN+IV++GL+ IS + K+RE+V+YV+G Sbjct: 375 FFHVRCSAHILNLIVQDGLEVISGALEKIRETVKYVKG 412