BLASTX nr result
ID: Catharanthus22_contig00018680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00018680 (873 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006363265.1| PREDICTED: putative pentatricopeptide repeat... 94 5e-17 gb|ESW25117.1| hypothetical protein PHAVU_003G008700g [Phaseolus... 93 1e-16 ref|XP_004239299.1| PREDICTED: putative pentatricopeptide repeat... 92 2e-16 gb|EMJ27928.1| hypothetical protein PRUPE_ppa019364mg, partial [... 91 7e-16 ref|XP_004491510.1| PREDICTED: putative pentatricopeptide repeat... 90 9e-16 ref|XP_003529187.2| PREDICTED: putative pentatricopeptide repeat... 90 1e-15 gb|EOX99670.1| Tetratricopeptide repeat-like superfamily protein... 88 4e-15 ref|XP_004310131.1| PREDICTED: putative pentatricopeptide repeat... 88 4e-15 ref|XP_002263197.2| PREDICTED: putative pentatricopeptide repeat... 88 4e-15 emb|CBI38188.3| unnamed protein product [Vitis vinifera] 88 4e-15 emb|CAN71462.1| hypothetical protein VITISV_018656 [Vitis vinifera] 88 4e-15 gb|EXC10733.1| hypothetical protein L484_025317 [Morus notabilis] 88 5e-15 gb|EPS74339.1| hypothetical protein M569_00411 [Genlisea aurea] 88 5e-15 ref|XP_003617808.1| Pentatricopeptide repeat-containing protein ... 88 5e-15 ref|XP_003567268.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-15 ref|XP_006578098.1| PREDICTED: pentatricopeptide repeat-containi... 87 8e-15 gb|ESW11389.1| hypothetical protein PHAVU_008G025900g [Phaseolus... 87 8e-15 ref|XP_002301973.2| pentatricopeptide repeat-containing family p... 87 8e-15 ref|XP_003552616.1| PREDICTED: pentatricopeptide repeat-containi... 87 8e-15 ref|XP_003531885.1| PREDICTED: pentatricopeptide repeat-containi... 87 8e-15 >ref|XP_006363265.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Solanum tuberosum] Length = 830 Score = 94.4 bits (233), Expect = 5e-17 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRICLDCHA IKFIS ++REIVIRDINRFHHFQNG CSCGDYW Sbjct: 784 IKNLRICLDCHAAIKFISTLVQREIVIRDINRFHHFQNGACSCGDYW 830 >gb|ESW25117.1| hypothetical protein PHAVU_003G008700g [Phaseolus vulgaris] Length = 806 Score = 93.2 bits (230), Expect = 1e-16 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRIC+DCH VIKFIS ++REIVIRDINRFHHFQ+GICSCGDYW Sbjct: 760 IKNLRICVDCHTVIKFISKIVQREIVIRDINRFHHFQHGICSCGDYW 806 >ref|XP_004239299.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Solanum lycopersicum] Length = 829 Score = 92.4 bits (228), Expect = 2e-16 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRICLDCHA IKFIS ++REIVIRDINRFHHFQ+G CSCGDYW Sbjct: 783 IKNLRICLDCHAAIKFISTLVQREIVIRDINRFHHFQSGACSCGDYW 829 >gb|EMJ27928.1| hypothetical protein PRUPE_ppa019364mg, partial [Prunus persica] Length = 824 Score = 90.5 bits (223), Expect = 7e-16 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRIC+DCHA +K IS ++R+IV+RDINRFHHFQNGICSCGDYW Sbjct: 778 IKNLRICVDCHATVKLISKVVQRDIVVRDINRFHHFQNGICSCGDYW 824 >ref|XP_004491510.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Cicer arietinum] Length = 813 Score = 90.1 bits (222), Expect = 9e-16 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRIC+DCHAVIK IS ++REIVIRDINRFHHF++G+CSCGDYW Sbjct: 767 IKNLRICVDCHAVIKLISKVVQREIVIRDINRFHHFRHGVCSCGDYW 813 >ref|XP_003529187.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Glycine max] Length = 822 Score = 89.7 bits (221), Expect = 1e-15 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRIC+DCHAVIK +S ++REIVIRDINRFHHF+ G+CSCGDYW Sbjct: 776 IKNLRICVDCHAVIKLVSKIVQREIVIRDINRFHHFRQGVCSCGDYW 822 >gb|EOX99670.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 833 Score = 88.2 bits (217), Expect = 4e-15 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRIC+DCHA +K IS ++R I+IRD+NRFHHFQNGICSCGDYW Sbjct: 787 IKNLRICVDCHAAMKLISKIVQRNIIIRDMNRFHHFQNGICSCGDYW 833 >ref|XP_004310131.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 733 Score = 88.2 bits (217), Expect = 4e-15 Identities = 34/47 (72%), Positives = 43/47 (91%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRIC+DCHA +K IS ++REI++RD+NRFHHFQ+GICSCGDYW Sbjct: 687 IKNLRICVDCHATVKLISKVVQREIIVRDMNRFHHFQDGICSCGDYW 733 >ref|XP_002263197.2| PREDICTED: putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial-like [Vitis vinifera] Length = 611 Score = 88.2 bits (217), Expect = 4e-15 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRIC+DCHA IK IS ++REIV+RDINRFHHFQ G+CSCGDYW Sbjct: 565 MKNLRICVDCHAAIKCISKVVQREIVVRDINRFHHFQEGLCSCGDYW 611 >emb|CBI38188.3| unnamed protein product [Vitis vinifera] Length = 744 Score = 88.2 bits (217), Expect = 4e-15 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRIC+DCHA IK IS ++REIV+RDINRFHHFQ G+CSCGDYW Sbjct: 698 MKNLRICVDCHAAIKCISKVVQREIVVRDINRFHHFQEGLCSCGDYW 744 >emb|CAN71462.1| hypothetical protein VITISV_018656 [Vitis vinifera] Length = 787 Score = 88.2 bits (217), Expect = 4e-15 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRIC+DCHA IK IS ++REIV+RDINRFHHFQ G+CSCGDYW Sbjct: 741 MKNLRICVDCHAAIKCISKVVQREIVVRDINRFHHFQEGLCSCGDYW 787 >gb|EXC10733.1| hypothetical protein L484_025317 [Morus notabilis] Length = 659 Score = 87.8 bits (216), Expect = 5e-15 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = -3 Query: 865 KNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 KNLR+C DCH+V KFIS F+ REIV+RD+NRFHHF++G+CSCGDYW Sbjct: 614 KNLRLCEDCHSVTKFISKFVNREIVVRDVNRFHHFRDGVCSCGDYW 659 >gb|EPS74339.1| hypothetical protein M569_00411 [Genlisea aurea] Length = 1063 Score = 87.8 bits (216), Expect = 5e-15 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -3 Query: 865 KNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 KNLRIC DCHAVIKFISGF REI +RD NR+HHF++GICSCGDYW Sbjct: 1018 KNLRICGDCHAVIKFISGFEGREISVRDTNRYHHFKDGICSCGDYW 1063 >ref|XP_003617808.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355519143|gb|AET00767.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 811 Score = 87.8 bits (216), Expect = 5e-15 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRIC+DCH V+K IS ++REIVIRDINRFHHF++G+CSCGDYW Sbjct: 765 IKNLRICIDCHTVMKLISKVVQREIVIRDINRFHHFRHGVCSCGDYW 811 >ref|XP_003567268.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Brachypodium distachyon] Length = 654 Score = 87.4 bits (215), Expect = 6e-15 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = -3 Query: 865 KNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 KNLR+C DCH+V KFIS F +REIV+RD+NRFHHF++G+CSCGDYW Sbjct: 609 KNLRLCEDCHSVTKFISKFTEREIVVRDVNRFHHFRDGVCSCGDYW 654 >ref|XP_006578098.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 980 Score = 87.0 bits (214), Expect = 8e-15 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLR+C DCH+ IK+IS KREIV+RD NRFHHF+NGICSCGDYW Sbjct: 934 IKNLRVCGDCHSAIKYISKVFKREIVLRDANRFHHFRNGICSCGDYW 980 >gb|ESW11389.1| hypothetical protein PHAVU_008G025900g [Phaseolus vulgaris] Length = 658 Score = 87.0 bits (214), Expect = 8e-15 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -3 Query: 865 KNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 KNLR+C DCHAV KFIS F REI++RD+NRFHHF++G+CSCGDYW Sbjct: 613 KNLRLCEDCHAVTKFISKFANREILVRDVNRFHHFRDGVCSCGDYW 658 >ref|XP_002301973.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344115|gb|EEE81246.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 724 Score = 87.0 bits (214), Expect = 8e-15 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = -3 Query: 868 LKNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 +KNLRIC DCHAVIKFIS F KREI +RD NRFH F+ G+CSCGDYW Sbjct: 678 IKNLRICRDCHAVIKFISDFEKREIFVRDTNRFHQFKGGVCSCGDYW 724 >ref|XP_003552616.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Glycine max] Length = 658 Score = 87.0 bits (214), Expect = 8e-15 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -3 Query: 865 KNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 KNLR+C DCHAV KFIS F REI++RD+NRFHHF++G+CSCGDYW Sbjct: 613 KNLRLCEDCHAVTKFISKFANREILVRDVNRFHHFKDGVCSCGDYW 658 >ref|XP_003531885.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46790, chloroplastic-like [Glycine max] Length = 658 Score = 87.0 bits (214), Expect = 8e-15 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -3 Query: 865 KNLRICLDCHAVIKFISGFMKREIVIRDINRFHHFQNGICSCGDYW 728 KNLR+C DCHAV KFIS F REI++RD+NRFHHF++G+CSCGDYW Sbjct: 613 KNLRLCEDCHAVTKFISKFANREILVRDVNRFHHFRDGVCSCGDYW 658