BLASTX nr result
ID: Catharanthus22_contig00018643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00018643 (1273 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006449610.1| hypothetical protein CICLE_v10014510mg [Citr... 40 8e-06 >ref|XP_006449610.1| hypothetical protein CICLE_v10014510mg [Citrus clementina] gi|557552221|gb|ESR62850.1| hypothetical protein CICLE_v10014510mg [Citrus clementina] Length = 668 Score = 40.0 bits (92), Expect(2) = 8e-06 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = +1 Query: 181 LEWKERKKFHKRLIAAKQTCREI 249 LEWKERKKF KRLIAAK+ RE+ Sbjct: 285 LEWKERKKFQKRLIAAKKKLREM 307 Score = 37.7 bits (86), Expect(2) = 8e-06 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = +2 Query: 233 RHVEKS*VSLLANEIVTVISKLLQQALHYIQMPT*RYTS 349 R EK +SLLAN IV + SKLLQQAL I++P+ R+ + Sbjct: 317 RFGEKYQMSLLANHIVGINSKLLQQALQNIEIPSKRWNA 355