BLASTX nr result
ID: Catharanthus22_contig00018468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00018468 (404 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB85101.1| hypothetical protein [Jatropha curcas] 56 4e-06 ref|XP_006356807.1| PREDICTED: ergosterol biosynthetic protein 2... 56 6e-06 ref|XP_004238052.1| PREDICTED: ergosterol biosynthetic protein 2... 56 6e-06 >gb|ADB85101.1| hypothetical protein [Jatropha curcas] Length = 129 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -3 Query: 402 LTTVGIFAGTSIVWMLLQWNAHQPAKTKDS 313 LTTVGIFAGTSIVWML+QWNAHQ + TK S Sbjct: 100 LTTVGIFAGTSIVWMLIQWNAHQKSHTKHS 129 >ref|XP_006356807.1| PREDICTED: ergosterol biosynthetic protein 28-like [Solanum tuberosum] Length = 129 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 402 LTTVGIFAGTSIVWMLLQWNAHQPAKTK 319 L TVGIFAGTSIVWMLLQWNAHQ KTK Sbjct: 100 LVTVGIFAGTSIVWMLLQWNAHQQVKTK 127 >ref|XP_004238052.1| PREDICTED: ergosterol biosynthetic protein 28-like [Solanum lycopersicum] Length = 129 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -3 Query: 402 LTTVGIFAGTSIVWMLLQWNAHQPAKTK 319 L TVGIFAGTSIVWMLLQWNAHQ KTK Sbjct: 100 LVTVGIFAGTSIVWMLLQWNAHQQVKTK 127