BLASTX nr result
ID: Catharanthus22_contig00018467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00018467 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006356807.1| PREDICTED: ergosterol biosynthetic protein 2... 57 2e-06 ref|XP_004238052.1| PREDICTED: ergosterol biosynthetic protein 2... 57 2e-06 ref|XP_006433697.1| hypothetical protein CICLE_v10002836mg [Citr... 55 1e-05 gb|AFK36233.1| unknown [Medicago truncatula] 55 1e-05 gb|ADB85101.1| hypothetical protein [Jatropha curcas] 55 1e-05 ref|XP_003603659.1| Ergosterol biosynthetic protein [Medicago tr... 55 1e-05 >ref|XP_006356807.1| PREDICTED: ergosterol biosynthetic protein 28-like [Solanum tuberosum] Length = 129 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 3 LTTVGIFAGTSIVWMLLQWNAHQPVKTK 86 L TVGIFAGTSIVWMLLQWNAHQ VKTK Sbjct: 100 LVTVGIFAGTSIVWMLLQWNAHQQVKTK 127 >ref|XP_004238052.1| PREDICTED: ergosterol biosynthetic protein 28-like [Solanum lycopersicum] Length = 129 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +3 Query: 3 LTTVGIFAGTSIVWMLLQWNAHQPVKTK 86 L TVGIFAGTSIVWMLLQWNAHQ VKTK Sbjct: 100 LVTVGIFAGTSIVWMLLQWNAHQQVKTK 127 >ref|XP_006433697.1| hypothetical protein CICLE_v10002836mg [Citrus clementina] gi|557535819|gb|ESR46937.1| hypothetical protein CICLE_v10002836mg [Citrus clementina] Length = 129 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 LTTVGIFAGTSIVWMLLQWNAHQPVKTKDS 92 LTTVGIFAGTSI+WMLLQWNA Q V KDS Sbjct: 100 LTTVGIFAGTSIIWMLLQWNARQQVHPKDS 129 >gb|AFK36233.1| unknown [Medicago truncatula] Length = 133 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 LTTVGIFAGTSIVWMLLQWNAHQPVKTKDS 92 LTTVGIFAGTSIVWMLLQWNAH V++K S Sbjct: 100 LTTVGIFAGTSIVWMLLQWNAHLKVRSKPS 129 >gb|ADB85101.1| hypothetical protein [Jatropha curcas] Length = 129 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 LTTVGIFAGTSIVWMLLQWNAHQPVKTKDS 92 LTTVGIFAGTSIVWML+QWNAHQ TK S Sbjct: 100 LTTVGIFAGTSIVWMLIQWNAHQKSHTKHS 129 >ref|XP_003603659.1| Ergosterol biosynthetic protein [Medicago truncatula] gi|355492707|gb|AES73910.1| Ergosterol biosynthetic protein [Medicago truncatula] gi|388499144|gb|AFK37638.1| unknown [Medicago truncatula] Length = 133 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +3 Query: 3 LTTVGIFAGTSIVWMLLQWNAHQPVKTKDS 92 LTTVGIFAGTSIVWMLLQWNAH V++K S Sbjct: 100 LTTVGIFAGTSIVWMLLQWNAHLKVRSKPS 129