BLASTX nr result
ID: Catharanthus22_contig00018369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00018369 (393 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHB79135.1| CBL10 [Nicotiana sylvestris] 59 7e-07 >gb|AHB79135.1| CBL10 [Nicotiana sylvestris] Length = 260 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/69 (47%), Positives = 41/69 (59%), Gaps = 3/69 (4%) Frame = +3 Query: 195 MDSTNNSLGSS-LTVTEKLCXXXXXXXXXXXXXXXXXSGCFECQPMHRP--KKLRYEFKD 365 MDST +SL SS LT++EK+C SGC ECQ ++RP KKL Y++ D Sbjct: 1 MDSTRDSLSSSSLTISEKICAAFFPIIALIEALIYAASGCLECQHLYRPNKKKLGYDYTD 60 Query: 366 LVRLAQESR 392 L RLA ESR Sbjct: 61 LARLANESR 69