BLASTX nr result
ID: Catharanthus22_contig00018359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00018359 (292 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37185.3| unnamed protein product [Vitis vinifera] 70 3e-10 >emb|CBI37185.3| unnamed protein product [Vitis vinifera] Length = 432 Score = 70.1 bits (170), Expect = 3e-10 Identities = 32/39 (82%), Positives = 37/39 (94%), Gaps = 1/39 (2%) Frame = +1 Query: 67 LLSMRLSTSNPHLCVLIFLTICLSGKEGP-FILEGPPCS 180 ++S+RLSTSNPHLC+LIFLTICLSGKEGP F +EGPPCS Sbjct: 1 MISIRLSTSNPHLCLLIFLTICLSGKEGPSFRIEGPPCS 39