BLASTX nr result
ID: Catharanthus22_contig00018292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00018292 (225 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB62334.1| Leucine-rich repeat-containing protein 48 [Morus ... 62 6e-08 >gb|EXB62334.1| Leucine-rich repeat-containing protein 48 [Morus notabilis] Length = 690 Score = 62.4 bits (150), Expect = 6e-08 Identities = 36/76 (47%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Frame = -1 Query: 225 GCDWKSEGM-GRNVIDCDMSLSNTVHPMKKCQSLGSGLDRQVRESGENASEYEIDQQFSC 49 G WKSE M + VID D+ + + + +KK QSLGSGL R+ R S +N E E DQ SC Sbjct: 73 GRGWKSEDMKNKFVIDSDLLIPHRGN-LKKSQSLGSGLYREGRVSADNDFEEETDQGLSC 131 Query: 48 DGSHDNSGYHGPNGAK 1 DGS D +G+ +G+K Sbjct: 132 DGSQDRNGFGARDGSK 147