BLASTX nr result
ID: Catharanthus22_contig00017940
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00017940 (552 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY12457.1| Uncharacterized protein TCM_030967 [Theobroma cacao] 59 8e-07 ref|XP_006452240.1| hypothetical protein CICLE_v10009906mg [Citr... 57 3e-06 >gb|EOY12457.1| Uncharacterized protein TCM_030967 [Theobroma cacao] Length = 227 Score = 58.9 bits (141), Expect = 8e-07 Identities = 36/79 (45%), Positives = 51/79 (64%), Gaps = 9/79 (11%) Frame = +2 Query: 323 SSSPPVQAAIHKSSTTGVFLIPKKMTAKTTPVEIGTKGTVASLIMQEIEYFSKLELECQ- 499 +S P++ ++H+S T+ +P +M A PVEIGT+GTV SL+M EIEYFS+LEL C+ Sbjct: 94 ASLNPIRQSMHRSKTSAK-KVPDEMAAHP-PVEIGTRGTVGSLVMLEIEYFSRLELSCRD 151 Query: 500 --------VIDKASTSNSS 532 V D AS+S+ S Sbjct: 152 SSEKPHPNVRDFASSSSHS 170 >ref|XP_006452240.1| hypothetical protein CICLE_v10009906mg [Citrus clementina] gi|557555466|gb|ESR65480.1| hypothetical protein CICLE_v10009906mg [Citrus clementina] Length = 126 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/40 (67%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +2 Query: 383 IPKKMTAKT-TPVEIGTKGTVASLIMQEIEYFSKLELECQ 499 +P+ M A TPVE+GT+GTV SLIM+EIEYFS+LEL CQ Sbjct: 11 VPENMAAPAHTPVEVGTRGTVGSLIMKEIEYFSQLELRCQ 50