BLASTX nr result
ID: Catharanthus22_contig00017486
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00017486 (322 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359995.1| PREDICTED: protein TOO MANY MOUTHS-like [Sol... 60 4e-07 ref|XP_006380230.1| hypothetical protein POPTR_0008s23160g [Popu... 58 1e-06 ref|XP_004248207.1| PREDICTED: protein TOO MANY MOUTHS-like [Sol... 58 1e-06 ref|XP_002328588.1| predicted protein [Populus trichocarpa] 58 1e-06 ref|XP_002280055.2| PREDICTED: LRR receptor-like serine/threonin... 57 2e-06 gb|EPS61431.1| hypothetical protein M569_13366 [Genlisea aurea] 55 9e-06 >ref|XP_006359995.1| PREDICTED: protein TOO MANY MOUTHS-like [Solanum tuberosum] Length = 455 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -3 Query: 173 HVEKTHNFQQTSNMDPRELETLFNIMETISSDQNWRISYPNPC 45 +V +N Q NM+P ELETL+ IME+ISSDQNWR SYPNPC Sbjct: 28 NVANINNLTQP-NMNPHELETLYKIMESISSDQNWRKSYPNPC 69 >ref|XP_006380230.1| hypothetical protein POPTR_0008s23160g [Populus trichocarpa] gi|550333751|gb|ERP58027.1| hypothetical protein POPTR_0008s23160g [Populus trichocarpa] Length = 443 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 137 NMDPRELETLFNIMETISSDQNWRISYPNPCN 42 NM P E+ET+F IME+ISSD+ WRISYPNPCN Sbjct: 26 NMLPSEVETIFKIMESISSDEKWRISYPNPCN 57 >ref|XP_004248207.1| PREDICTED: protein TOO MANY MOUTHS-like [Solanum lycopersicum] Length = 442 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -3 Query: 140 SNMDPRELETLFNIMETISSDQNWRISYPNPC 45 SNM+P ELETL+ IME+IS+DQ+WR SYPNPC Sbjct: 32 SNMNPHELETLYKIMESISNDQDWRRSYPNPC 63 >ref|XP_002328588.1| predicted protein [Populus trichocarpa] Length = 398 Score = 57.8 bits (138), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -3 Query: 137 NMDPRELETLFNIMETISSDQNWRISYPNPCN 42 NM P E+ET+F IME+ISSD+ WRISYPNPCN Sbjct: 11 NMLPSEVETIFKIMESISSDEKWRISYPNPCN 42 >ref|XP_002280055.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA-like [Vitis vinifera] gi|147832384|emb|CAN62290.1| hypothetical protein VITISV_017315 [Vitis vinifera] Length = 427 Score = 57.0 bits (136), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 134 MDPRELETLFNIMETISSDQNWRISYPNPCN 42 MDP E ETLFNIM+++SSD WRIS+PNPCN Sbjct: 1 MDPSEAETLFNIMDSMSSDHTWRISFPNPCN 31 >gb|EPS61431.1| hypothetical protein M569_13366 [Genlisea aurea] Length = 439 Score = 55.1 bits (131), Expect = 9e-06 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -3 Query: 137 NMDPRELETLFNIMETISSDQNWRISYPNPC 45 +MDP ELETL+ IME++SSDQ+WR +YPNPC Sbjct: 18 DMDPVELETLYGIMESLSSDQDWRAAYPNPC 48