BLASTX nr result
ID: Catharanthus22_contig00017202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00017202 (229 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006429693.1| hypothetical protein CICLE_v10013226mg [Citr... 56 4e-06 >ref|XP_006429693.1| hypothetical protein CICLE_v10013226mg [Citrus clementina] gi|557531750|gb|ESR42933.1| hypothetical protein CICLE_v10013226mg [Citrus clementina] Length = 86 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -3 Query: 224 EEACLAFHDQDYVEKIKEFHFYLDSVTKIVKPGCSQEVLNVAL 96 + A L D++Y+ KIKEF YLD V KI KPGCSQEVL VAL Sbjct: 21 KSAGLCTEDEEYITKIKEFQAYLDLVQKIAKPGCSQEVLKVAL 63