BLASTX nr result
ID: Catharanthus22_contig00016955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00016955 (223 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004231980.1| PREDICTED: oligopeptidase A-like [Solanum ly... 57 2e-06 >ref|XP_004231980.1| PREDICTED: oligopeptidase A-like [Solanum lycopersicum] Length = 807 Score = 57.4 bits (137), Expect = 2e-06 Identities = 31/59 (52%), Positives = 37/59 (62%), Gaps = 5/59 (8%) Frame = +1 Query: 4 ICLRTSSIAYRSYPKHLLKSQSCPLWSSSFSLCLHTLR-----SKSTTVNPRRPISATV 165 +CLR +S R K+LL+ SCPLWSSSFSLCLHT R KS TV P SA++ Sbjct: 44 LCLRPTSTFSRLSTKNLLQCPSCPLWSSSFSLCLHTFRKSTSPGKSITVRSFSPSSASI 102