BLASTX nr result
ID: Catharanthus22_contig00016191
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00016191 (318 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 99 4e-19 ref|YP_173386.1| hypothetical protein NitaMp040 [Nicotiana tabac... 55 5e-16 ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 84 1e-14 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 99.4 bits (246), Expect = 4e-19 Identities = 46/48 (95%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = -1 Query: 153 HF-PSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLRLFGRHG 13 HF PSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVL+LFGRHG Sbjct: 556 HFVPSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLKLFGRHG 603 >ref|YP_173386.1| hypothetical protein NitaMp040 [Nicotiana tabacum] gi|56806549|dbj|BAD83450.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 108 Score = 55.1 bits (131), Expect(3) = 5e-16 Identities = 27/31 (87%), Positives = 29/31 (93%), Gaps = 1/31 (3%) Frame = +1 Query: 166 FVTRPRLRVLWTLRPPATSGSKLAP-VGERG 255 F+TRPRLRVLWTLRPPATSGSKLAP VG+ G Sbjct: 11 FLTRPRLRVLWTLRPPATSGSKLAPYVGKLG 41 Score = 50.8 bits (120), Expect(3) = 5e-16 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +2 Query: 239 RLGKEGISIAKDSIQPQVPLRLPCYD 316 +LG+E ISIAKDSIQPQVPLRLPCYD Sbjct: 39 KLGEECISIAKDSIQPQVPLRLPCYD 64 Score = 23.5 bits (49), Expect(3) = 5e-16 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 135 MNKKENGTF*FCDSP 179 MNKKENGT F P Sbjct: 1 MNKKENGTILFLTRP 15 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 84.3 bits (207), Expect = 1e-14 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +1 Query: 1 HRACTMSPEQSQYIWRKTIPHIEVGMGSGVFTSHRSARFVLISD 132 +RA TMSPEQSQYIWRKTIPHIEVGMGSGVFTS+RSARFVLI D Sbjct: 41 YRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSYRSARFVLIPD 84