BLASTX nr result
ID: Catharanthus22_contig00016116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00016116 (832 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512560.1| Polygalacturonase precursor, putative [Ricin... 64 5e-08 ref|XP_002276945.1| PREDICTED: polygalacturonase At1g48100 [Viti... 62 3e-07 ref|XP_006344808.1| PREDICTED: polygalacturonase At1g48100-like ... 59 3e-06 ref|XP_006344807.1| PREDICTED: polygalacturonase At1g48100-like ... 59 3e-06 gb|EMJ22769.1| hypothetical protein PRUPE_ppa024649mg, partial [... 59 3e-06 gb|EMJ07397.1| hypothetical protein PRUPE_ppa014719mg [Prunus pe... 59 3e-06 ref|XP_003591344.1| Polygalacturonase [Medicago truncatula] gi|3... 59 3e-06 ref|XP_006604753.1| PREDICTED: polygalacturonase At1g48100-like ... 58 4e-06 ref|XP_006577178.1| PREDICTED: polygalacturonase At1g48100-like ... 58 4e-06 gb|ESW35210.1| hypothetical protein PHAVU_001G215900g [Phaseolus... 58 4e-06 gb|ESW17111.1| hypothetical protein PHAVU_007G211400g [Phaseolus... 58 4e-06 ref|XP_002320271.2| hypothetical protein POPTR_0014s11110g [Popu... 58 4e-06 ref|XP_006605259.1| PREDICTED: polygalacturonase At1g48100-like ... 58 5e-06 ref|XP_006492459.1| PREDICTED: polygalacturonase At1g48100-like ... 58 5e-06 ref|XP_006444572.1| hypothetical protein CICLE_v10024556mg [Citr... 58 5e-06 ref|XP_003553676.1| PREDICTED: polygalacturonase At1g48100-like ... 58 5e-06 ref|XP_003520763.1| PREDICTED: polygalacturonase At1g48100-like ... 58 5e-06 gb|EXB56004.1| Polygalacturonase [Morus notabilis] 57 6e-06 gb|EXB50292.1| Polygalacturonase [Morus notabilis] 57 6e-06 ref|XP_006349249.1| PREDICTED: polygalacturonase At1g48100-like ... 57 6e-06 >ref|XP_002512560.1| Polygalacturonase precursor, putative [Ricinus communis] gi|223548521|gb|EEF50012.1| Polygalacturonase precursor, putative [Ricinus communis] Length = 470 Score = 64.3 bits (155), Expect = 5e-08 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIKTTIVS 337 A+RFF+ NLT Q LKVKNSP+FHF FDNC NVH E+L IK +S Sbjct: 208 ALRFFMSSNLTVQGLKVKNSPQFHFRFDNCQNVHIEMLNIKAPALS 253 >ref|XP_002276945.1| PREDICTED: polygalacturonase At1g48100 [Vitis vinifera] gi|296089826|emb|CBI39645.3| unnamed protein product [Vitis vinifera] Length = 464 Score = 62.0 bits (149), Expect = 3e-07 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIK 352 AIRFF NLT Q LK+KNSP+FHF FDNC NVH +LL IK Sbjct: 202 AIRFFTSSNLTVQGLKIKNSPQFHFRFDNCQNVHIDLLNIK 242 >ref|XP_006344808.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Solanum tuberosum] Length = 476 Score = 58.5 bits (140), Expect = 3e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIK 352 AIRFF+ NLT Q LK+KNSP FHF FD+C +VH + L+IK Sbjct: 214 AIRFFMSSNLTVQGLKIKNSPLFHFRFDSCRDVHVDSLYIK 254 >ref|XP_006344807.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Solanum tuberosum] Length = 477 Score = 58.5 bits (140), Expect = 3e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIK 352 AIRFF+ NLT Q LK+KNSP FHF FD+C +VH + L+IK Sbjct: 215 AIRFFMSSNLTVQGLKIKNSPLFHFRFDSCRDVHVDSLYIK 255 >gb|EMJ22769.1| hypothetical protein PRUPE_ppa024649mg, partial [Prunus persica] Length = 437 Score = 58.5 bits (140), Expect = 3e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFI 355 AI+FF+ NLT Q LK+KNSP+FHF FDNC NVH E + I Sbjct: 175 AIKFFMSSNLTVQGLKIKNSPQFHFRFDNCRNVHIESISI 214 >gb|EMJ07397.1| hypothetical protein PRUPE_ppa014719mg [Prunus persica] Length = 419 Score = 58.5 bits (140), Expect = 3e-06 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIKTTIVS 337 AIRFF+ NL+ LKVKNSP+FHF FDNC NV+ E L IKT +S Sbjct: 157 AIRFFMSSNLSVIGLKVKNSPQFHFRFDNCQNVYIESLNIKTPALS 202 >ref|XP_003591344.1| Polygalacturonase [Medicago truncatula] gi|355480392|gb|AES61595.1| Polygalacturonase [Medicago truncatula] Length = 478 Score = 58.5 bits (140), Expect = 3e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIKTTIVS 337 AIRFF+ NLT Q L++KNSP+FHF FD C +VH E +FI +S Sbjct: 216 AIRFFMSSNLTVQGLRIKNSPQFHFRFDGCQSVHVESIFITAPALS 261 >ref|XP_006604753.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Glycine max] Length = 447 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -2 Query: 477 QAIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFI 355 +AIRFF+ NLT Q L++KNSP+FHF FD C NVH E ++I Sbjct: 184 KAIRFFMSSNLTVQGLRIKNSPQFHFRFDGCKNVHIESIYI 224 >ref|XP_006577178.1| PREDICTED: polygalacturonase At1g48100-like isoform X2 [Glycine max] Length = 447 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -2 Query: 477 QAIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFI 355 +AIRFF+ NLT Q L++KNSP+FHF FD C NVH E ++I Sbjct: 184 KAIRFFMSSNLTVQGLRIKNSPQFHFRFDGCKNVHIESIYI 224 >gb|ESW35210.1| hypothetical protein PHAVU_001G215900g [Phaseolus vulgaris] Length = 460 Score = 58.2 bits (139), Expect = 4e-06 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFI 355 AIRFF+ NLT Q L+VKNSP+FHF FD C NVH E ++I Sbjct: 198 AIRFFMSSNLTVQGLRVKNSPQFHFRFDGCKNVHIESIYI 237 >gb|ESW17111.1| hypothetical protein PHAVU_007G211400g [Phaseolus vulgaris] Length = 474 Score = 58.2 bits (139), Expect = 4e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIKTTIVS 337 A+RFF+ NLT Q LK+KNSP+FHF FD C +VH E ++I + +S Sbjct: 212 ALRFFMSSNLTVQGLKIKNSPQFHFRFDGCESVHVESIYITSPALS 257 >ref|XP_002320271.2| hypothetical protein POPTR_0014s11110g [Populus trichocarpa] gi|550323965|gb|EEE98586.2| hypothetical protein POPTR_0014s11110g [Populus trichocarpa] Length = 526 Score = 58.2 bits (139), Expect = 4e-06 Identities = 27/46 (58%), Positives = 33/46 (71%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIKTTIVS 337 AIRFF+ NLT Q LK+KNSP+F+F FDNC NVH E + I +S Sbjct: 264 AIRFFMSSNLTVQGLKIKNSPQFNFRFDNCKNVHVESIHITAPALS 309 >ref|XP_006605259.1| PREDICTED: polygalacturonase At1g48100-like [Glycine max] Length = 533 Score = 57.8 bits (138), Expect = 5e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIKTTIVS 337 AIRFF NL + LK+KNSP+FHF FD C NVH E L IK+ +S Sbjct: 268 AIRFFESSNLRVEGLKIKNSPKFHFRFDECQNVHVEKLIIKSPALS 313 >ref|XP_006492459.1| PREDICTED: polygalacturonase At1g48100-like [Citrus sinensis] Length = 584 Score = 57.8 bits (138), Expect = 5e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIKTTIVS 337 A+RFF+ NLT Q+L++K+SP+FHF FDNC NVH E + I +S Sbjct: 322 ALRFFMSSNLTVQRLRIKDSPQFHFRFDNCKNVHIESIHITAPALS 367 >ref|XP_006444572.1| hypothetical protein CICLE_v10024556mg [Citrus clementina] gi|557546834|gb|ESR57812.1| hypothetical protein CICLE_v10024556mg [Citrus clementina] Length = 603 Score = 57.8 bits (138), Expect = 5e-06 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIKTTIVS 337 A+RFF+ NLT Q+L++K+SP+FHF FDNC NVH E + I +S Sbjct: 341 ALRFFMSSNLTVQRLRIKDSPQFHFRFDNCKNVHIESIHITAPALS 386 >ref|XP_003553676.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Glycine max] Length = 462 Score = 57.8 bits (138), Expect = 5e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFI 355 AIRFF+ NLT Q L++KNSP+FHF FD C NVH E ++I Sbjct: 200 AIRFFMSSNLTVQGLRIKNSPQFHFRFDGCKNVHIESIYI 239 >ref|XP_003520763.1| PREDICTED: polygalacturonase At1g48100-like isoform X1 [Glycine max] Length = 462 Score = 57.8 bits (138), Expect = 5e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFI 355 AIRFF+ NLT Q L++KNSP+FHF FD C NVH E ++I Sbjct: 200 AIRFFMSSNLTVQGLRIKNSPQFHFRFDGCKNVHIESIYI 239 >gb|EXB56004.1| Polygalacturonase [Morus notabilis] Length = 750 Score = 57.4 bits (137), Expect = 6e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIKTTIVS 337 AIRFF+ NLT Q L++KNSP+FHF FD+C NVH E + I +S Sbjct: 486 AIRFFMSSNLTVQGLRIKNSPQFHFRFDSCQNVHIESISITAPALS 531 >gb|EXB50292.1| Polygalacturonase [Morus notabilis] Length = 483 Score = 57.4 bits (137), Expect = 6e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIKTTIVS 337 AIRFF+ NLT Q L++KNSP+FHF FD+C NVH E + I +S Sbjct: 219 AIRFFMSSNLTVQGLRIKNSPQFHFRFDSCQNVHIESISITAPALS 264 >ref|XP_006349249.1| PREDICTED: polygalacturonase At1g48100-like [Solanum tuberosum] Length = 472 Score = 57.4 bits (137), Expect = 6e-06 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -2 Query: 474 AIRFFLRPNLTFQQLKVKNSPRFHFWFDNCHNVHKELLFIKTTIVS 337 AIRFF+ NLT Q +K+KNSP+F+F FDNC NVH E L I I S Sbjct: 205 AIRFFMSSNLTVQGIKMKNSPQFNFRFDNCKNVHIESLHITAPIWS 250