BLASTX nr result
ID: Catharanthus22_contig00015836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00015836 (706 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006348619.1| PREDICTED: uncharacterized protein LOC102602... 61 4e-07 ref|XP_004253455.1| PREDICTED: uncharacterized protein LOC101245... 61 4e-07 ref|XP_006844190.1| hypothetical protein AMTR_s00006p00263990 [A... 57 6e-06 ref|XP_002514531.1| conserved hypothetical protein [Ricinus comm... 56 1e-05 >ref|XP_006348619.1| PREDICTED: uncharacterized protein LOC102602378 [Solanum tuberosum] Length = 290 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -1 Query: 706 LLLSCASFVFLLHIFYAVFFIKYGMKASLRLPRWLASAI 590 LL++CA FV LLH+ YA+F K+GMKA+LRLPRWLA AI Sbjct: 252 LLINCAFFVSLLHLLYAIFLTKFGMKANLRLPRWLAIAI 290 >ref|XP_004253455.1| PREDICTED: uncharacterized protein LOC101245935, partial [Solanum lycopersicum] Length = 177 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -1 Query: 706 LLLSCASFVFLLHIFYAVFFIKYGMKASLRLPRWLASAI 590 LL++CA FV LLH+ YA+F K+GMKA+LRLPRWLA AI Sbjct: 139 LLINCAFFVSLLHLLYAIFLTKFGMKANLRLPRWLAIAI 177 >ref|XP_006844190.1| hypothetical protein AMTR_s00006p00263990 [Amborella trichopoda] gi|548846589|gb|ERN05865.1| hypothetical protein AMTR_s00006p00263990 [Amborella trichopoda] Length = 294 Score = 57.0 bits (136), Expect = 6e-06 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = -1 Query: 706 LLLSCASFVFLLHIFYAVFFIKYGMKASLRLPRWLASAI 590 LLL+C FVFLLH+ YAVF + GMK SL LPRWL AI Sbjct: 256 LLLNCGFFVFLLHVLYAVFLSRLGMKVSLSLPRWLEKAI 294 >ref|XP_002514531.1| conserved hypothetical protein [Ricinus communis] gi|223546135|gb|EEF47637.1| conserved hypothetical protein [Ricinus communis] Length = 306 Score = 56.2 bits (134), Expect = 1e-05 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -1 Query: 706 LLLSCASFVFLLHIFYAVFFIKYGMKASLRLPRWLASAI 590 +LL+ SFVFLLH+ Y+VFF + GMK SLRLPRWL A+ Sbjct: 267 VLLNSGSFVFLLHLLYSVFFTRLGMKDSLRLPRWLEKAL 305