BLASTX nr result
ID: Catharanthus22_contig00015369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00015369 (205 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ09951.2| putative gag-pol polyprotein [Citrus sinensis] 55 1e-05 >emb|CAJ09951.2| putative gag-pol polyprotein [Citrus sinensis] Length = 1334 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/65 (35%), Positives = 42/65 (64%) Frame = +3 Query: 9 SDDDDEDYPEAQAQALRDYQLSRDKIRRESRKPARYGYSYIVSYAFAAASYLEEKEPMCF 188 ++ ++ + E L++YQL+RD++RRE R P RYGY+ +++YA A + +EP F Sbjct: 758 AESEEHEVSELPQADLQNYQLARDRVRREVRAPVRYGYADLIAYALLCADEVTIEEPANF 817 Query: 189 SDVLK 203 S+ ++ Sbjct: 818 SEAME 822