BLASTX nr result
ID: Catharanthus22_contig00015336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00015336 (279 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ05931.1| hypothetical protein PRUPE_ppa011346mg [Prunus pe... 63 4e-08 ref|XP_004287880.1| PREDICTED: soluble inorganic pyrophosphatase... 63 5e-08 gb|AFP74895.1| soluble inorganic pyrophosphatase [Hevea brasilie... 62 6e-08 ref|XP_004232423.1| PREDICTED: soluble inorganic pyrophosphatase... 61 1e-07 ref|XP_004143524.1| PREDICTED: soluble inorganic pyrophosphatase... 60 2e-07 ref|XP_006466825.1| PREDICTED: soluble inorganic pyrophosphatase... 60 3e-07 ref|XP_006466824.1| PREDICTED: soluble inorganic pyrophosphatase... 60 3e-07 ref|XP_006466823.1| PREDICTED: soluble inorganic pyrophosphatase... 60 3e-07 ref|XP_006425645.1| hypothetical protein CICLE_v10026346mg [Citr... 60 3e-07 ref|XP_006425644.1| hypothetical protein CICLE_v10026346mg [Citr... 60 3e-07 ref|XP_006425643.1| hypothetical protein CICLE_v10026346mg [Citr... 60 3e-07 gb|EXC35449.1| Soluble inorganic pyrophosphatase [Morus notabilis] 60 4e-07 ref|XP_006340642.1| PREDICTED: soluble inorganic pyrophosphatase... 60 4e-07 ref|XP_002521557.1| inorganic pyrophosphatase, putative [Ricinus... 60 4e-07 gb|AFK45917.1| unknown [Lotus japonicus] 59 9e-07 ref|NP_001236147.1| uncharacterized protein LOC100306258 [Glycin... 59 9e-07 gb|ESW28965.1| hypothetical protein PHAVU_002G032700g [Phaseolus... 58 1e-06 ref|XP_004512066.1| PREDICTED: soluble inorganic pyrophosphatase... 57 2e-06 gb|AFK40071.1| unknown [Medicago truncatula] 57 2e-06 ref|XP_003612059.1| Soluble inorganic pyrophosphatase [Medicago ... 57 2e-06 >gb|EMJ05931.1| hypothetical protein PRUPE_ppa011346mg [Prunus persica] Length = 214 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +3 Query: 3 AVEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 AVEDFLPAEAAIDAI+YSMDLYASYIVESLRQ Sbjct: 183 AVEDFLPAEAAIDAIKYSMDLYASYIVESLRQ 214 >ref|XP_004287880.1| PREDICTED: soluble inorganic pyrophosphatase-like [Fragaria vesca subsp. vesca] Length = 216 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = +3 Query: 3 AVEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 AVEDFLPAEAA+DAI+YSMDLYASYIVESLRQ Sbjct: 185 AVEDFLPAEAAVDAIKYSMDLYASYIVESLRQ 216 >gb|AFP74895.1| soluble inorganic pyrophosphatase [Hevea brasiliensis] Length = 215 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +3 Query: 3 AVEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 AVEDFLPAEAAIDAI YSMDLYASYIVESLRQ Sbjct: 184 AVEDFLPAEAAIDAINYSMDLYASYIVESLRQ 215 >ref|XP_004232423.1| PREDICTED: soluble inorganic pyrophosphatase-like [Solanum lycopersicum] Length = 214 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = +3 Query: 3 AVEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 AVEDFLPAEAA+DAI+YSMDLYASYIVESLR+ Sbjct: 183 AVEDFLPAEAAVDAIKYSMDLYASYIVESLRK 214 >ref|XP_004143524.1| PREDICTED: soluble inorganic pyrophosphatase-like [Cucumis sativus] gi|449522764|ref|XP_004168396.1| PREDICTED: soluble inorganic pyrophosphatase-like [Cucumis sativus] Length = 239 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 VEDFLPAEAAIDAI+YSMDLYA+YIVESLRQ Sbjct: 209 VEDFLPAEAAIDAIKYSMDLYAAYIVESLRQ 239 >ref|XP_006466825.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X3 [Citrus sinensis] Length = 214 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 VEDFLPAEAAI+AI+YSMDLYASYIVESLRQ Sbjct: 184 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 214 >ref|XP_006466824.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X2 [Citrus sinensis] Length = 248 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 VEDFLPAEAAI+AI+YSMDLYASYIVESLRQ Sbjct: 218 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 248 >ref|XP_006466823.1| PREDICTED: soluble inorganic pyrophosphatase-like isoform X1 [Citrus sinensis] Length = 283 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 VEDFLPAEAAI+AI+YSMDLYASYIVESLRQ Sbjct: 253 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 283 >ref|XP_006425645.1| hypothetical protein CICLE_v10026346mg [Citrus clementina] gi|557527635|gb|ESR38885.1| hypothetical protein CICLE_v10026346mg [Citrus clementina] Length = 214 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 VEDFLPAEAAI+AI+YSMDLYASYIVESLRQ Sbjct: 184 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 214 >ref|XP_006425644.1| hypothetical protein CICLE_v10026346mg [Citrus clementina] gi|557527634|gb|ESR38884.1| hypothetical protein CICLE_v10026346mg [Citrus clementina] Length = 248 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 VEDFLPAEAAI+AI+YSMDLYASYIVESLRQ Sbjct: 218 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 248 >ref|XP_006425643.1| hypothetical protein CICLE_v10026346mg [Citrus clementina] gi|557527633|gb|ESR38883.1| hypothetical protein CICLE_v10026346mg [Citrus clementina] Length = 179 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 VEDFLPAEAAI+AI+YSMDLYASYIVESLRQ Sbjct: 149 VEDFLPAEAAIEAIKYSMDLYASYIVESLRQ 179 >gb|EXC35449.1| Soluble inorganic pyrophosphatase [Morus notabilis] Length = 227 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 VE+FLPAEAAIDAI+YSMDLYASYI+ESLRQ Sbjct: 197 VEEFLPAEAAIDAIKYSMDLYASYIIESLRQ 227 >ref|XP_006340642.1| PREDICTED: soluble inorganic pyrophosphatase-like [Solanum tuberosum] Length = 214 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +3 Query: 3 AVEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 AVEDFLPAEAA++AI+YSMDLYASYIVESLR+ Sbjct: 183 AVEDFLPAEAAVEAIKYSMDLYASYIVESLRK 214 >ref|XP_002521557.1| inorganic pyrophosphatase, putative [Ricinus communis] gi|223539235|gb|EEF40828.1| inorganic pyrophosphatase, putative [Ricinus communis] Length = 212 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 VEDFLPAEAAI+AI+YSMDLYASYIVESLRQ Sbjct: 182 VEDFLPAEAAINAIKYSMDLYASYIVESLRQ 212 >gb|AFK45917.1| unknown [Lotus japonicus] Length = 216 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 VEDFLPAEAA++AI+YSMDLYA+YIVESLRQ Sbjct: 186 VEDFLPAEAAVEAIKYSMDLYAAYIVESLRQ 216 >ref|NP_001236147.1| uncharacterized protein LOC100306258 [Glycine max] gi|255628027|gb|ACU14358.1| unknown [Glycine max] Length = 213 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLR 95 VEDFLPAEAAIDAI+YSMDLYA+YIVESLR Sbjct: 183 VEDFLPAEAAIDAIKYSMDLYAAYIVESLR 212 >gb|ESW28965.1| hypothetical protein PHAVU_002G032700g [Phaseolus vulgaris] Length = 213 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLR 95 VEDFLPAEAA+DAI+YSMDLYA+YIVESLR Sbjct: 183 VEDFLPAEAAVDAIKYSMDLYAAYIVESLR 212 >ref|XP_004512066.1| PREDICTED: soluble inorganic pyrophosphatase-like [Cicer arietinum] Length = 209 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 VEDFLPA+AAID+I+YSMDLYASYIVESLR+ Sbjct: 179 VEDFLPAKAAIDSIKYSMDLYASYIVESLRK 209 >gb|AFK40071.1| unknown [Medicago truncatula] Length = 216 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 V+DFLPAE+A+DAI+YSMDLYASYIVESLR+ Sbjct: 183 VDDFLPAESAVDAIKYSMDLYASYIVESLRK 213 >ref|XP_003612059.1| Soluble inorganic pyrophosphatase [Medicago truncatula] gi|355513394|gb|AES95017.1| Soluble inorganic pyrophosphatase [Medicago truncatula] Length = 154 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = +3 Query: 6 VEDFLPAEAAIDAIRYSMDLYASYIVESLRQ 98 V+DFLPAE+A+DAI+YSMDLYASYIVESLR+ Sbjct: 124 VDDFLPAESAVDAIKYSMDLYASYIVESLRK 154