BLASTX nr result
ID: Catharanthus22_contig00015200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00015200 (400 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004240748.1| PREDICTED: probable carboxylesterase 120-lik... 66 5e-09 ref|XP_006357922.1| PREDICTED: probable carboxylesterase 120-lik... 65 7e-09 ref|XP_006348784.1| PREDICTED: probable carboxylesterase 120-lik... 65 7e-09 ref|XP_006361622.1| PREDICTED: probable carboxylesterase 120-lik... 62 8e-08 ref|XP_006370782.1| hypothetical protein POPTR_0001s47060g, part... 60 2e-07 ref|XP_002300570.2| hypothetical protein POPTR_0001s47050g [Popu... 60 3e-07 ref|XP_006375315.1| hypothetical protein POPTR_0014s06900g [Popu... 58 1e-06 ref|XP_002320079.1| predicted protein [Populus trichocarpa] 58 1e-06 gb|EMJ20894.1| hypothetical protein PRUPE_ppa023957mg [Prunus pe... 58 1e-06 ref|XP_006445209.1| hypothetical protein CICLE_v10020996mg [Citr... 57 3e-06 gb|AAF77578.1|AF072533_1 pepper esterase [Capsicum annuum] 56 6e-06 ref|XP_002511752.1| Gibberellin receptor GID1, putative [Ricinus... 56 6e-06 ref|XP_006387388.1| hypothetical protein POPTR_1116s00200g, part... 55 7e-06 >ref|XP_004240748.1| PREDICTED: probable carboxylesterase 120-like [Solanum lycopersicum] Length = 326 Score = 65.9 bits (159), Expect = 5e-09 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTVRFFSDGYHAMEVFDPAMSGPFYDVTKDFI 246 DPLVDA +++E KG++ +FF DGYHAMEVFD +M+ YD KDF+ Sbjct: 270 DPLVDAARACVRLMEQKGIKVFKFFRDGYHAMEVFDQSMAAALYDAAKDFV 320 >ref|XP_006357922.1| PREDICTED: probable carboxylesterase 120-like [Solanum tuberosum] Length = 326 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTVRFFSDGYHAMEVFDPAMSGPFYDVTKDFI 246 DPLVDA +++E KG++ +FF DGYHAMEVFD +M+ YD KDF+ Sbjct: 270 DPLVDAARGCVRLMEEKGIKVFKFFRDGYHAMEVFDQSMAAALYDAAKDFV 320 >ref|XP_006348784.1| PREDICTED: probable carboxylesterase 120-like [Solanum tuberosum] Length = 326 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTVRFFSDGYHAMEVFDPAMSGPFYDVTKDFI 246 DPLVDA +++E KG++ +FF DGYHAMEVFD +M+ YD KDF+ Sbjct: 270 DPLVDAARGCVRLMEQKGIKVFKFFRDGYHAMEVFDQSMAAALYDAAKDFV 320 >ref|XP_006361622.1| PREDICTED: probable carboxylesterase 120-like [Solanum tuberosum] Length = 327 Score = 62.0 bits (149), Expect = 8e-08 Identities = 24/53 (45%), Positives = 37/53 (69%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTVRFFSDGYHAMEVFDPAMSGPFYDVTKDFITS 240 DPLVD A +E KG++T + F DGYH +E+F+P+M+ +D T+DFI++ Sbjct: 272 DPLVDGARNFANFVEEKGIKTFKLFGDGYHVVELFEPSMAAVLFDATRDFISA 324 >ref|XP_006370782.1| hypothetical protein POPTR_0001s47060g, partial [Populus trichocarpa] gi|550350059|gb|ERP67351.1| hypothetical protein POPTR_0001s47060g, partial [Populus trichocarpa] Length = 322 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTV-RFFSDGYHAMEVFDPAMSGPFYDVTKDFI 246 DPLVD EL KMLES+G+ V RF DG+H +EVFDPA + FYD K+F+ Sbjct: 267 DPLVDKQKELVKMLESRGVDVVARFDEDGFHGVEVFDPAKAKAFYDYGKEFV 318 >ref|XP_002300570.2| hypothetical protein POPTR_0001s47050g [Populus trichocarpa] gi|550350058|gb|EEE85375.2| hypothetical protein POPTR_0001s47050g [Populus trichocarpa] Length = 325 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/52 (55%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTVRFFS-DGYHAMEVFDPAMSGPFYDVTKDFI 246 DPLVD EL KMLES+G+ V F DG+H +EVFDPA + FYD K+F+ Sbjct: 270 DPLVDKQKELVKMLESRGVDVVAMFDEDGFHGVEVFDPAKAKAFYDYVKEFV 321 >ref|XP_006375315.1| hypothetical protein POPTR_0014s06900g [Populus trichocarpa] gi|550323666|gb|ERP53112.1| hypothetical protein POPTR_0014s06900g [Populus trichocarpa] Length = 295 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/54 (53%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTV-RFFSDGYHAMEVFDPAMSGPFYDVTKDFITS 240 DPLVD EL KMLES+G+ V +F DG+HA+EVFDPA YD K+F+ + Sbjct: 239 DPLVDKQKELVKMLESRGVDVVTKFDEDGFHAVEVFDPAKLKVLYDYVKEFVNT 292 >ref|XP_002320079.1| predicted protein [Populus trichocarpa] Length = 324 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/54 (53%), Positives = 37/54 (68%), Gaps = 1/54 (1%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTV-RFFSDGYHAMEVFDPAMSGPFYDVTKDFITS 240 DPLVD EL KMLES+G+ V +F DG+HA+EVFDPA YD K+F+ + Sbjct: 268 DPLVDKQKELVKMLESRGVDVVTKFDEDGFHAVEVFDPAKLKVLYDYVKEFVNT 321 >gb|EMJ20894.1| hypothetical protein PRUPE_ppa023957mg [Prunus persica] Length = 310 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/51 (49%), Positives = 36/51 (70%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTVRFFSDGYHAMEVFDPAMSGPFYDVTKDFI 246 DPL+D +EL KMLE KG+RT+ F +G+H +EV DP+ + + V K+FI Sbjct: 257 DPLIDRQMELGKMLEGKGVRTMTHFGNGFHGLEVSDPSKAPALFTVLKNFI 307 >ref|XP_006445209.1| hypothetical protein CICLE_v10020996mg [Citrus clementina] gi|568875764|ref|XP_006490960.1| PREDICTED: probable carboxylesterase 8-like [Citrus sinensis] gi|557547471|gb|ESR58449.1| hypothetical protein CICLE_v10020996mg [Citrus clementina] Length = 340 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/51 (47%), Positives = 35/51 (68%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTVRFFSDGYHAMEVFDPAMSGPFYDVTKDFI 246 DPL+D EL+KMLE++G+ V F DGYHA E+FDP+ + Y ++F+ Sbjct: 267 DPLIDRQKELSKMLEARGVHVVPQFDDGYHACELFDPSKAEALYKAVQEFV 317 >gb|AAF77578.1|AF072533_1 pepper esterase [Capsicum annuum] Length = 328 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/51 (47%), Positives = 32/51 (62%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTVRFFSDGYHAMEVFDPAMSGPFYDVTKDFI 246 DPLVD A +E KG++T + F DGYHA+E F+P+ + TKDFI Sbjct: 273 DPLVDNARNFANFMEEKGIKTFKLFGDGYHAIEGFEPSKAAALIGATKDFI 323 >ref|XP_002511752.1| Gibberellin receptor GID1, putative [Ricinus communis] gi|223548932|gb|EEF50421.1| Gibberellin receptor GID1, putative [Ricinus communis] Length = 340 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/52 (53%), Positives = 35/52 (67%), Gaps = 1/52 (1%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTVRFFS-DGYHAMEVFDPAMSGPFYDVTKDFI 246 DPLVD E AK L+S G++ V FS DG+HA+E+FDP + P YD K FI Sbjct: 283 DPLVDKQKEFAKKLQSNGVKVVSSFSEDGFHAVELFDPLKAQPLYDDVKTFI 334 >ref|XP_006387388.1| hypothetical protein POPTR_1116s00200g, partial [Populus trichocarpa] gi|550306887|gb|ERP46302.1| hypothetical protein POPTR_1116s00200g, partial [Populus trichocarpa] Length = 120 Score = 55.5 bits (132), Expect = 7e-06 Identities = 28/54 (51%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Frame = -3 Query: 398 DPLVDAGIELAKMLESKGLRTV-RFFSDGYHAMEVFDPAMSGPFYDVTKDFITS 240 DPLV EL KMLES+G+ V +F DG+HA+EVFDPA YD K+F+ + Sbjct: 64 DPLVGKQKELVKMLESRGVDVVTKFDEDGFHAVEVFDPAKLKVLYDYVKEFVNT 117