BLASTX nr result
ID: Catharanthus22_contig00015047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00015047 (386 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAL16409.1| pathogenesis-related protein PR10a [Nicotiana tab... 73 3e-11 ref|XP_006341397.1| PREDICTED: major allergen Pru ar 1-like [Sol... 72 1e-10 ref|XP_004236450.1| PREDICTED: major allergen Pru ar 1-like [Sol... 72 1e-10 ref|XP_004236449.1| PREDICTED: major allergen Pru ar 1-like [Sol... 72 1e-10 ref|XP_002519167.1| Major allergen Pru ar, putative [Ricinus com... 67 3e-09 gb|EOY06614.1| Major pollen allergen Car b 1 [Theobroma cacao] 66 6e-09 gb|EMJ25402.1| hypothetical protein PRUPE_ppa017373mg [Prunus pe... 64 2e-08 gb|EXB95730.1| Major allergen Pru ar 1 [Morus notabilis] 64 2e-08 gb|EOY06616.1| Uncharacterized protein isoform 1 [Theobroma caca... 62 1e-07 ref|XP_003631944.1| PREDICTED: LOW QUALITY PROTEIN: major allerg... 62 1e-07 gb|EOY20426.1| Uncharacterized protein TCM_046315 [Theobroma cacao] 61 1e-07 gb|EOY00073.1| Uncharacterized protein TCM_009534 [Theobroma cacao] 61 2e-07 gb|EOY09985.1| Uncharacterized protein TCM_025354 [Theobroma cacao] 60 2e-07 gb|EOY09989.1| Uncharacterized protein TCM_025358 [Theobroma cacao] 60 3e-07 emb|CBL94145.1| putative Mal d 1.12 isoallergen [Malus domestica] 60 3e-07 ref|XP_002522800.1| Major allergen Pru ar, putative [Ricinus com... 60 4e-07 ref|XP_002516996.1| Major allergen Pru ar, putative [Ricinus com... 59 7e-07 gb|EOY06618.1| Pathogenesis-related protein 10.5 [Theobroma cacao] 59 9e-07 gb|EOY06612.1| MLP-like protein 423 [Theobroma cacao] 59 9e-07 emb|CBJ49378.1| pathogenesis-related protein 10.6 [Vitis vinifera] 59 9e-07 >gb|AAL16409.1| pathogenesis-related protein PR10a [Nicotiana tabacum] Length = 102 Score = 73.2 bits (178), Expect = 3e-11 Identities = 40/66 (60%), Positives = 46/66 (69%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 + L +NLE I+Y+VKFE S DGGSI KV S Y Y DFKLNE+EIK GKEKV M+ V Sbjct: 32 DGLVDNLEKISYDVKFEQSADGGSISKVTSTY--YTVGDFKLNEEEIKAGKEKVSAMFKV 89 Query: 181 GETMLL 198 E LL Sbjct: 90 VEAYLL 95 >ref|XP_006341397.1| PREDICTED: major allergen Pru ar 1-like [Solanum tuberosum] Length = 159 Score = 71.6 bits (174), Expect = 1e-10 Identities = 39/66 (59%), Positives = 44/66 (66%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 + L +NLE ITY+VKFE S DGGSI KV S Y Y DFKL E+EIK GKEKV M+ Sbjct: 89 DGLVDNLEKITYDVKFEQSADGGSISKVTSSY--YTVGDFKLKEEEIKAGKEKVLAMFKA 146 Query: 181 GETMLL 198 E LL Sbjct: 147 VEAYLL 152 >ref|XP_004236450.1| PREDICTED: major allergen Pru ar 1-like [Solanum lycopersicum] Length = 159 Score = 71.6 bits (174), Expect = 1e-10 Identities = 39/66 (59%), Positives = 44/66 (66%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 + L +NLE ITY+VKFE S DGGSI KV S Y Y DFKL E+EIK GKEKV M+ Sbjct: 89 DGLVDNLEKITYDVKFEQSADGGSISKVTSSY--YTVGDFKLKEEEIKAGKEKVLAMFKA 146 Query: 181 GETMLL 198 E LL Sbjct: 147 VEAYLL 152 >ref|XP_004236449.1| PREDICTED: major allergen Pru ar 1-like [Solanum lycopersicum] Length = 159 Score = 71.6 bits (174), Expect = 1e-10 Identities = 39/66 (59%), Positives = 44/66 (66%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 + L +NLE ITY+VKFE S DGGSI KV S Y Y DFKL E+EIK GKEKV M+ Sbjct: 89 DGLVDNLEKITYDVKFEQSADGGSISKVTSSY--YTVGDFKLKEEEIKAGKEKVLAMFKA 146 Query: 181 GETMLL 198 E LL Sbjct: 147 VEAYLL 152 >ref|XP_002519167.1| Major allergen Pru ar, putative [Ricinus communis] gi|223541482|gb|EEF43031.1| Major allergen Pru ar, putative [Ricinus communis] Length = 169 Score = 66.6 bits (161), Expect = 3e-09 Identities = 35/70 (50%), Positives = 44/70 (62%) Frame = +1 Query: 7 LTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNVGE 186 LT LE ITY+VKFE S DGG I K SKY Y DF+LN ++++ GKEKV GM+ E Sbjct: 102 LTNGLEKITYDVKFEQSSDGGCICKENSKY--YTIGDFELNMEQLQAGKEKVLGMFKAVE 159 Query: 187 TMLLLQLSSC 216 +L +C Sbjct: 160 AYILANPDTC 169 >gb|EOY06614.1| Major pollen allergen Car b 1 [Theobroma cacao] Length = 197 Score = 65.9 bits (159), Expect = 6e-09 Identities = 36/66 (54%), Positives = 43/66 (65%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 + L + LE ITY+VKFEP+ DGGS K+ S Y Y DF L E+EIKTGKEK MY V Sbjct: 127 DGLMDKLEKITYDVKFEPTADGGSKNKMTSTY--YTKGDFVLTEEEIKTGKEKALAMYKV 184 Query: 181 GETMLL 198 E L+ Sbjct: 185 VEGYLI 190 >gb|EMJ25402.1| hypothetical protein PRUPE_ppa017373mg [Prunus persica] Length = 161 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/64 (53%), Positives = 44/64 (68%) Frame = +1 Query: 7 LTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNVGE 186 + E LE ++YEVKFE ++DGGS K+ SKY + DF L E++IKTG+EK GMY V E Sbjct: 93 IMEKLEYVSYEVKFEAAEDGGSKNKMVSKY--HTKGDFVLQEEDIKTGREKALGMYKVVE 150 Query: 187 TMLL 198 LL Sbjct: 151 AYLL 154 >gb|EXB95730.1| Major allergen Pru ar 1 [Morus notabilis] Length = 171 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/63 (49%), Positives = 46/63 (73%) Frame = +1 Query: 7 LTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNVGE 186 LTE +E I+YEV+FE + +GG + K+RS+Y I +DF+++E+EI+ GKE+ GMY V E Sbjct: 92 LTEKIEYISYEVEFEKASEGGCVCKMRSEYHI--AQDFEIDEEEIRIGKERAIGMYRVVE 149 Query: 187 TML 195 L Sbjct: 150 AYL 152 >gb|EOY06616.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508714720|gb|EOY06617.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 158 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/66 (50%), Positives = 42/66 (63%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 ++L E I+YE K EPS DGGSI K SKY Y DF++ E+EIK+GKEK G++ Sbjct: 90 DALMNAFEKISYETKLEPSPDGGSICKSTSKY--YTIGDFEIKEEEIKSGKEKALGLFKA 147 Query: 181 GETMLL 198 E LL Sbjct: 148 IEAYLL 153 >ref|XP_003631944.1| PREDICTED: LOW QUALITY PROTEIN: major allergen Pru ar 1-like [Vitis vinifera] Length = 159 Score = 61.6 bits (148), Expect = 1e-07 Identities = 33/66 (50%), Positives = 42/66 (63%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 ++L LE I+YEVK PS DGGSI K SKY + DF++ ED+IK GKEK G++ Sbjct: 90 DALMGTLESISYEVKLVPSPDGGSICKSTSKY--HTKGDFEITEDQIKAGKEKAMGLFKA 147 Query: 181 GETMLL 198 E LL Sbjct: 148 VEAYLL 153 >gb|EOY20426.1| Uncharacterized protein TCM_046315 [Theobroma cacao] Length = 159 Score = 61.2 bits (147), Expect = 1e-07 Identities = 33/66 (50%), Positives = 40/66 (60%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 ++L LE ITYE K EPS GGS+ K SKY Y DF+L E+ +K GKEK GM+ Sbjct: 90 DALMNMLEKITYETKLEPSPAGGSLCKTTSKY--YTKGDFELKEEGVKAGKEKALGMFKA 147 Query: 181 GETMLL 198 E LL Sbjct: 148 VEAYLL 153 >gb|EOY00073.1| Uncharacterized protein TCM_009534 [Theobroma cacao] Length = 198 Score = 60.8 bits (146), Expect = 2e-07 Identities = 33/66 (50%), Positives = 40/66 (60%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 ++L LE +TYE K EPS GGS+ K SKY Y DF+L E+ IK GKEK GM+ Sbjct: 129 DALMNMLEKVTYETKLEPSPAGGSVCKTTSKY--YTIGDFELKEEGIKAGKEKALGMFKA 186 Query: 181 GETMLL 198 E LL Sbjct: 187 VEAYLL 192 >gb|EOY09985.1| Uncharacterized protein TCM_025354 [Theobroma cacao] Length = 205 Score = 60.5 bits (145), Expect = 2e-07 Identities = 33/66 (50%), Positives = 41/66 (62%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 ++L + LE ITYE K EPS GGSI K SKY Y DF++ E+ IK GKEK G++ Sbjct: 136 DALMKTLEKITYETKLEPSPAGGSICKTTSKY--YTIGDFEIKEEGIKAGKEKALGIFKA 193 Query: 181 GETMLL 198 E LL Sbjct: 194 VEAYLL 199 >gb|EOY09989.1| Uncharacterized protein TCM_025358 [Theobroma cacao] Length = 159 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/66 (50%), Positives = 40/66 (60%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 ++L LE ITYE K EPS GGSI K SKY Y DF++ E+ IK GKEK G++ Sbjct: 90 DALMNTLEKITYETKLEPSPAGGSICKTTSKY--YTIGDFEIKEEGIKAGKEKALGIFKA 147 Query: 181 GETMLL 198 E LL Sbjct: 148 VEAYLL 153 >emb|CBL94145.1| putative Mal d 1.12 isoallergen [Malus domestica] Length = 146 Score = 60.1 bits (144), Expect = 3e-07 Identities = 33/64 (51%), Positives = 40/64 (62%) Frame = +1 Query: 7 LTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNVGE 186 + E LE ITY+ KFE + DGGS ++ S Y Y D L E+EIK G+EK GMY V E Sbjct: 78 VVEKLEYITYKAKFEAASDGGSKNRLVSNY--YTKGDIVLKEEEIKAGREKALGMYRVVE 135 Query: 187 TMLL 198 T LL Sbjct: 136 TYLL 139 >ref|XP_002522800.1| Major allergen Pru ar, putative [Ricinus communis] gi|223538038|gb|EEF39651.1| Major allergen Pru ar, putative [Ricinus communis] Length = 158 Score = 59.7 bits (143), Expect = 4e-07 Identities = 31/69 (44%), Positives = 44/69 (63%) Frame = +1 Query: 10 TENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNVGET 189 ++N+E + YE+K S DGGSI K SKY Y + +L+E++IKTG EK +GM+ ET Sbjct: 91 SDNIEKVCYEIKILASPDGGSICKSSSKY--YPKEGCQLDEEKIKTGAEKAFGMFKAIET 148 Query: 190 MLLLQLSSC 216 LL +C Sbjct: 149 HLLTNPDAC 157 >ref|XP_002516996.1| Major allergen Pru ar, putative [Ricinus communis] gi|223544084|gb|EEF45610.1| Major allergen Pru ar, putative [Ricinus communis] Length = 108 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/69 (44%), Positives = 43/69 (62%) Frame = +1 Query: 10 TENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNVGET 189 ++N+E I+YE+K S DGGSI K SKY Y + +L+ED+IK G EK +GM+ E Sbjct: 41 SDNIEKISYEIKIVASPDGGSICKSSSKY--YPKEGCELDEDKIKAGAEKAFGMFKTIEA 98 Query: 190 MLLLQLSSC 216 LL +C Sbjct: 99 HLLANPDAC 107 >gb|EOY06618.1| Pathogenesis-related protein 10.5 [Theobroma cacao] Length = 159 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/66 (50%), Positives = 40/66 (60%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 ++L LE ITYE K E S GGSI K SKY Y DF++ E+ IK GKEK G++ V Sbjct: 90 DALMNTLEKITYETKLEQSPAGGSICKTTSKY--YTIGDFEITEEGIKAGKEKALGIFKV 147 Query: 181 GETMLL 198 E LL Sbjct: 148 VEAYLL 153 >gb|EOY06612.1| MLP-like protein 423 [Theobroma cacao] Length = 160 Score = 58.5 bits (140), Expect = 9e-07 Identities = 31/66 (46%), Positives = 42/66 (63%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 ++L + LE I YEVKFE DGG I K+ S Y + +F++ E+EIK GK+K G+Y V Sbjct: 90 DALGDKLECIAYEVKFETISDGGCICKMTSNY--HTLGEFEIKEEEIKAGKDKAMGIYKV 147 Query: 181 GETMLL 198 E LL Sbjct: 148 VEAYLL 153 >emb|CBJ49378.1| pathogenesis-related protein 10.6 [Vitis vinifera] Length = 119 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/66 (50%), Positives = 41/66 (62%) Frame = +1 Query: 1 NSLTENLEMITYEVKFEPSQDGGSIFKVRSKYCIYKGKDFKLNEDEIKTGKEKVWGMYNV 180 ++L +NLE I YEVK S DGGSI K SKY + D ++ ED+IK GKEK GM+ Sbjct: 50 DALMDNLESIYYEVKLVASPDGGSICKNISKY--HTKGDIQITEDQIKAGKEKAMGMFKA 107 Query: 181 GETMLL 198 E LL Sbjct: 108 IEAYLL 113