BLASTX nr result
ID: Catharanthus22_contig00014952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00014952 (533 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q42435.1|CCS_CAPAN RecName: Full=Capsanthin/capsorubin syntha... 57 2e-07 gb|ADH04285.1| capsanthin/capsorubin synthase [Capsicum annuum] ... 57 2e-07 emb|CAA54961.1| putative chromoplastic oxydo-reductase [Capsicum... 57 2e-07 ref|XP_006361083.1| PREDICTED: neoxanthin synthase, chloroplasti... 57 3e-07 sp|Q9M424.1|NXS_SOLTU RecName: Full=Neoxanthin synthase, chlorop... 57 3e-07 gb|ADZ24717.1| lycopene b-cyclase [Solanum pennellii] 57 3e-07 gb|EOY33385.1| Lycopene cyclase [Theobroma cacao] 57 3e-07 gb|AFP28803.1| lycopene beta-cyclase 1 [Vitis vinifera] 56 3e-07 ref|XP_002273862.1| PREDICTED: capsanthin/capsorubin synthase, c... 56 3e-07 emb|CAN64939.1| hypothetical protein VITISV_021720 [Vitis vinifera] 56 3e-07 emb|CAB93342.1| neoxanthin synthase [Solanum lycopersicum] 57 6e-07 ref|NP_001234445.1| chromoplast-specific lycopene beta-cyclase [... 57 6e-07 ref|XP_002328232.1| predicted protein [Populus trichocarpa] gi|5... 55 6e-07 emb|CAJ57435.1| lycopene beta cyclase [Solanum lycopersicum] 57 6e-07 ref|XP_006424195.1| hypothetical protein CICLE_v10028245mg [Citr... 55 8e-07 gb|ACX37456.1| chromoplast lycopene beta-cyclase [Citrus x parad... 55 8e-07 ref|XP_006487912.1| PREDICTED: capsanthin/capsorubin synthase, c... 55 8e-07 dbj|BAM66329.1| LCYb2, partial [Citrus limon] 55 8e-07 dbj|BAM66328.1| LCYb2, partial [Citrus sinensis] 55 8e-07 gb|AFR11777.1| lycopene beta-cyclase [Fragaria x ananassa] 55 1e-06 >sp|Q42435.1|CCS_CAPAN RecName: Full=Capsanthin/capsorubin synthase, chromoplast; Flags: Precursor gi|468748|emb|CAA54495.1| capsanthin/capsorubin synthase [Capsicum annuum] gi|522120|emb|CAA53759.1| capsanthin/capsorubin sythase [Capsicum annuum] Length = 498 Score = 57.0 bits (136), Expect(2) = 2e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 Q++HGILAEVDNHP DLDK+++ D R S+LGNEP + Sbjct: 236 QVAHGILAEVDNHPFDLDKMMLMDWRDSHLGNEPYL 271 Score = 23.5 bits (49), Expect(2) = 2e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 229 KPRNHGYQ 236 >gb|ADH04285.1| capsanthin/capsorubin synthase [Capsicum annuum] gi|296278645|gb|ADH04286.1| capsanthin/capsorubin synthase [Capsicum annuum] gi|296278647|gb|ADH04287.1| capsanthin/capsorubin synthase [Capsicum annuum] gi|296278649|gb|ADH04288.1| capsanthin/capsorubin synthase [Capsicum annuum] gi|296278651|gb|ADH04289.1| capsanthin/capsorubin synthase [Capsicum annuum] gi|296278653|gb|ADH04290.1| capsanthin/capsorubin synthase [Capsicum annuum] Length = 498 Score = 57.0 bits (136), Expect(2) = 2e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 Q++HGILAEVDNHP DLDK+++ D R S+LGNEP + Sbjct: 236 QVAHGILAEVDNHPFDLDKMMLMDWRDSHLGNEPYL 271 Score = 23.5 bits (49), Expect(2) = 2e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 229 KPRNHGYQ 236 >emb|CAA54961.1| putative chromoplastic oxydo-reductase [Capsicum annuum] Length = 471 Score = 57.0 bits (136), Expect(2) = 2e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 Q++HGILAEVDNHP DLDK+++ D R S+LGNEP + Sbjct: 236 QVAHGILAEVDNHPFDLDKMMLMDWRDSHLGNEPYL 271 Score = 23.5 bits (49), Expect(2) = 2e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 229 KPRNHGYQ 236 >ref|XP_006361083.1| PREDICTED: neoxanthin synthase, chloroplastic-like [Solanum tuberosum] Length = 498 Score = 56.6 bits (135), Expect(2) = 3e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HG+L EVDNHP DLDK+V+ D R S+LGNEP + Sbjct: 236 QIAHGVLVEVDNHPFDLDKMVLMDWRDSHLGNEPYL 271 Score = 23.5 bits (49), Expect(2) = 3e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 229 KPRNHGYQ 236 >sp|Q9M424.1|NXS_SOLTU RecName: Full=Neoxanthin synthase, chloroplastic; Flags: Precursor gi|8247354|emb|CAB92977.1| neoxanthin synthase [Solanum tuberosum] Length = 498 Score = 56.6 bits (135), Expect(2) = 3e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HG+L EVDNHP DLDK+V+ D R S+LGNEP + Sbjct: 236 QIAHGVLVEVDNHPFDLDKMVLMDWRDSHLGNEPYL 271 Score = 23.5 bits (49), Expect(2) = 3e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 229 KPRNHGYQ 236 >gb|ADZ24717.1| lycopene b-cyclase [Solanum pennellii] Length = 498 Score = 56.6 bits (135), Expect(2) = 3e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HG+L EVDNHP DLDK+V+ D R S+LGNEP + Sbjct: 236 QIAHGVLVEVDNHPFDLDKMVLMDWRDSHLGNEPYL 271 Score = 23.5 bits (49), Expect(2) = 3e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 229 KPRNHGYQ 236 >gb|EOY33385.1| Lycopene cyclase [Theobroma cacao] Length = 496 Score = 56.6 bits (135), Expect(2) = 3e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HGILAEVD+HP DLDK+V+ D R S+LGNEP + Sbjct: 234 QIAHGILAEVDSHPFDLDKMVLMDWRDSHLGNEPYL 269 Score = 23.5 bits (49), Expect(2) = 3e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 227 KPRNHGYQ 234 >gb|AFP28803.1| lycopene beta-cyclase 1 [Vitis vinifera] Length = 497 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HGILAEVD+HP DLDK+++ D R S+LGNEP I Sbjct: 235 QIAHGILAEVDSHPFDLDKMLLMDWRDSHLGNEPYI 270 Score = 23.5 bits (49), Expect(2) = 3e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 228 KPRNHGYQ 235 >ref|XP_002273862.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast [Vitis vinifera] Length = 497 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HGILAEVD+HP DLDK+++ D R S+LGNEP I Sbjct: 235 QIAHGILAEVDSHPFDLDKMLLMDWRDSHLGNEPYI 270 Score = 23.5 bits (49), Expect(2) = 3e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 228 KPRNHGYQ 235 >emb|CAN64939.1| hypothetical protein VITISV_021720 [Vitis vinifera] Length = 480 Score = 56.2 bits (134), Expect(2) = 3e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HGILAEVD+HP DLDK+++ D R S+LGNEP I Sbjct: 235 QIAHGILAEVDSHPFDLDKMLLMDWRDSHLGNEPYI 270 Score = 23.5 bits (49), Expect(2) = 3e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 228 KPRNHGYQ 235 >emb|CAB93342.1| neoxanthin synthase [Solanum lycopersicum] Length = 498 Score = 56.6 bits (135), Expect(2) = 6e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HG+L EVDNHP DLDK+V+ D R S+LGNEP + Sbjct: 236 QIAHGVLVEVDNHPFDLDKMVLMDWRDSHLGNEPYL 271 Score = 22.3 bits (46), Expect(2) = 6e-07 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 +PRNHGYQ Sbjct: 229 RPRNHGYQ 236 >ref|NP_001234445.1| chromoplast-specific lycopene beta-cyclase [Solanum lycopersicum] gi|10644119|gb|AAG21133.1| chromoplast-specific lycopene beta-cyclase [Solanum lycopersicum] Length = 498 Score = 56.6 bits (135), Expect(2) = 6e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HG+L EVDNHP DLDK+V+ D R S+LGNEP + Sbjct: 236 QIAHGVLVEVDNHPFDLDKMVLMDWRDSHLGNEPYL 271 Score = 22.3 bits (46), Expect(2) = 6e-07 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 +PRNHGYQ Sbjct: 229 RPRNHGYQ 236 >ref|XP_002328232.1| predicted protein [Populus trichocarpa] gi|566167657|ref|XP_006384755.1| hypothetical protein POPTR_0004s20800g [Populus trichocarpa] gi|550341523|gb|ERP62552.1| hypothetical protein POPTR_0004s20800g [Populus trichocarpa] Length = 496 Score = 55.5 bits (132), Expect(2) = 6e-07 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HGILAEVD HP DLDK+V+ D R S+LGNEP + Sbjct: 234 QIAHGILAEVDYHPFDLDKMVLMDWRDSHLGNEPCL 269 Score = 23.5 bits (49), Expect(2) = 6e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 227 KPRNHGYQ 234 >emb|CAJ57435.1| lycopene beta cyclase [Solanum lycopersicum] Length = 165 Score = 56.6 bits (135), Expect(2) = 6e-07 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HG+L EVDNHP DLDK+V+ D R S+LGNEP + Sbjct: 115 QIAHGVLVEVDNHPFDLDKMVLMDWRDSHLGNEPYL 150 Score = 22.3 bits (46), Expect(2) = 6e-07 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 +PRNHGYQ Sbjct: 108 RPRNHGYQ 115 >ref|XP_006424195.1| hypothetical protein CICLE_v10028245mg [Citrus clementina] gi|11131528|sp|Q9SEA0.1|CCS_CITSI RecName: Full=Capsanthin/capsorubin synthase, chromoplast; Flags: Precursor gi|6580973|gb|AAF18389.1|AF169241_1 capsanthin/capsorubin synthase [Citrus sinensis] gi|237664127|gb|ACR09634.1| lycopene beta-cyclase [Citrus sinensis] gi|557526129|gb|ESR37435.1| hypothetical protein CICLE_v10028245mg [Citrus clementina] Length = 503 Score = 55.1 bits (131), Expect(2) = 8e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HGILAEV++HP DLDK+V+ D R S+LGNEP + Sbjct: 241 QIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYL 276 Score = 23.5 bits (49), Expect(2) = 8e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 234 KPRNHGYQ 241 >gb|ACX37456.1| chromoplast lycopene beta-cyclase [Citrus x paradisi] Length = 503 Score = 55.1 bits (131), Expect(2) = 8e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HGILAEV++HP DLDK+V+ D R S+LGNEP + Sbjct: 241 QIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYL 276 Score = 23.5 bits (49), Expect(2) = 8e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 234 KPRNHGYQ 241 >ref|XP_006487912.1| PREDICTED: capsanthin/capsorubin synthase, chromoplast-like [Citrus sinensis] gi|237664129|gb|ACR09635.1| lycopene beta-cyclase [Citrus x paradisi] Length = 503 Score = 55.1 bits (131), Expect(2) = 8e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HGILAEV++HP DLDK+V+ D R S+LGNEP + Sbjct: 241 QIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYL 276 Score = 23.5 bits (49), Expect(2) = 8e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 234 KPRNHGYQ 241 >dbj|BAM66329.1| LCYb2, partial [Citrus limon] Length = 479 Score = 55.1 bits (131), Expect(2) = 8e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HGILAEV++HP DLDK+V+ D R S+LGNEP + Sbjct: 229 QIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYL 264 Score = 23.5 bits (49), Expect(2) = 8e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 222 KPRNHGYQ 229 >dbj|BAM66328.1| LCYb2, partial [Citrus sinensis] Length = 479 Score = 55.1 bits (131), Expect(2) = 8e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HGILAEV++HP DLDK+V+ D R S+LGNEP + Sbjct: 229 QIAHGILAEVESHPFDLDKMVLMDWRDSHLGNEPYL 264 Score = 23.5 bits (49), Expect(2) = 8e-07 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 222 KPRNHGYQ 229 >gb|AFR11777.1| lycopene beta-cyclase [Fragaria x ananassa] Length = 498 Score = 54.7 bits (130), Expect(2) = 1e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +3 Query: 243 QISHGILAEVDNHPSDLDKIVIKDGRHSYLGNEPII 350 QI+HGILAEV+ HP DLDK+V+ D R S+LGNEP + Sbjct: 236 QIAHGILAEVEGHPFDLDKMVLMDWRDSHLGNEPYL 271 Score = 23.5 bits (49), Expect(2) = 1e-06 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +2 Query: 218 KPRNHGYQ 241 KPRNHGYQ Sbjct: 229 KPRNHGYQ 236