BLASTX nr result
ID: Catharanthus22_contig00013256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00013256 (387 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACU14371.1| unknown [Glycine max] 56 4e-06 >gb|ACU14371.1| unknown [Glycine max] Length = 96 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/35 (74%), Positives = 27/35 (77%) Frame = -1 Query: 387 SWKLHPLGTRKRSSFNIAKALAISRQPSSSVHKPI 283 SWK HPLG RKRSSFNIA A A R PSS VH+PI Sbjct: 18 SWKPHPLGARKRSSFNIASAFARRRNPSSKVHRPI 52