BLASTX nr result
ID: Catharanthus22_contig00013182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00013182 (1802 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002327939.1| predicted protein [Populus trichocarpa] 59 7e-06 >ref|XP_002327939.1| predicted protein [Populus trichocarpa] Length = 248 Score = 58.9 bits (141), Expect = 7e-06 Identities = 35/88 (39%), Positives = 52/88 (59%), Gaps = 2/88 (2%) Frame = -3 Query: 1800 HWQKPLSGWLKPNFDASWESPCDTTSVI-ITRDEKGKLLEGNNPN-KARDPFEAEALTAL 1627 HW+KP G++K N DAS++ C +SV + RDE G L G + K+ FEAE L Sbjct: 54 HWKKPPLGFVKLNTDASYKYNCSKSSVAGVCRDEHGIWLFGFSSRVKSGSAFEAELLAVR 113 Query: 1626 HAIKLAQRKGFSLVVLEEDTLNVLRSLQ 1543 A+KLA KG V++E D+ +V+ ++ Sbjct: 114 EALKLAWDKGLKRVIVESDSESVVNRIR 141