BLASTX nr result
ID: Catharanthus22_contig00012947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00012947 (663 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006367599.1| PREDICTED: serine/arginine-rich splicing fac... 84 5e-14 ref|XP_006367598.1| PREDICTED: serine/arginine-rich splicing fac... 84 5e-14 ref|XP_004228663.1| PREDICTED: serine/arginine-rich splicing fac... 80 5e-13 ref|XP_006354141.1| PREDICTED: serine/arginine-rich splicing fac... 80 7e-13 emb|CBI16510.3| unnamed protein product [Vitis vinifera] 79 9e-13 ref|XP_002285703.1| PREDICTED: uncharacterized protein LOC100263... 79 9e-13 ref|XP_004294999.1| PREDICTED: serine/arginine-rich splicing fac... 74 4e-11 ref|XP_006445639.1| hypothetical protein CICLE_v10016371mg [Citr... 74 5e-11 ref|XP_002532060.1| serine/arginine rich splicing factor, putati... 72 1e-10 ref|XP_003544854.1| PREDICTED: serine/arginine-rich splicing fac... 71 3e-10 gb|EMJ06950.1| hypothetical protein PRUPE_ppa010237mg [Prunus pe... 70 6e-10 ref|XP_006386054.1| hypothetical protein POPTR_0003s21240g [Popu... 68 3e-09 ref|XP_004502205.1| PREDICTED: serine/arginine-rich splicing fac... 68 3e-09 ref|XP_004502204.1| PREDICTED: serine/arginine-rich splicing fac... 68 3e-09 gb|ABK92507.1| unknown [Populus trichocarpa] 68 3e-09 gb|ESW35836.1| hypothetical protein PHAVU_001G268900g [Phaseolus... 67 6e-09 ref|XP_003601611.1| Arginine/serine-rich splicing factor [Medica... 65 2e-08 ref|XP_003601610.1| Arginine/serine-rich splicing factor [Medica... 65 2e-08 gb|ACU22994.1| unknown [Glycine max] 64 3e-08 ref|XP_006574390.1| PREDICTED: uncharacterized protein LOC100779... 64 4e-08 >ref|XP_006367599.1| PREDICTED: serine/arginine-rich splicing factor 33-like isoform X2 [Solanum tuberosum] Length = 243 Score = 83.6 bits (205), Expect = 5e-14 Identities = 45/69 (65%), Positives = 53/69 (76%), Gaps = 11/69 (15%) Frame = +3 Query: 105 RDYYSPPPKRRQYSRSVSPQEKRYSRERS----------YSHSPARERS-PYDGPRNRSR 251 RDYYSPP KRRQYSRSVSP+EKRYSRERS YS SP RE+S P++G R+RS+ Sbjct: 124 RDYYSPP-KRRQYSRSVSPEEKRYSRERSYSPRGGQGRAYSQSPPREQSPPFNGSRSRSQ 182 Query: 252 TPVRDQSPP 278 +PVR+ SPP Sbjct: 183 SPVREHSPP 191 >ref|XP_006367598.1| PREDICTED: serine/arginine-rich splicing factor 33-like isoform X1 [Solanum tuberosum] Length = 280 Score = 83.6 bits (205), Expect = 5e-14 Identities = 45/69 (65%), Positives = 53/69 (76%), Gaps = 11/69 (15%) Frame = +3 Query: 105 RDYYSPPPKRRQYSRSVSPQEKRYSRERS----------YSHSPARERS-PYDGPRNRSR 251 RDYYSPP KRRQYSRSVSP+EKRYSRERS YS SP RE+S P++G R+RS+ Sbjct: 161 RDYYSPP-KRRQYSRSVSPEEKRYSRERSYSPRGGQGRAYSQSPPREQSPPFNGSRSRSQ 219 Query: 252 TPVRDQSPP 278 +PVR+ SPP Sbjct: 220 SPVREHSPP 228 >ref|XP_004228663.1| PREDICTED: serine/arginine-rich splicing factor 33-like isoform 1 [Solanum lycopersicum] gi|460365550|ref|XP_004228664.1| PREDICTED: serine/arginine-rich splicing factor 33-like isoform 2 [Solanum lycopersicum] Length = 252 Score = 80.1 bits (196), Expect = 5e-13 Identities = 42/66 (63%), Positives = 51/66 (77%), Gaps = 2/66 (3%) Frame = +3 Query: 99 HNRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERS--PYDGPRNRSRTPVRDQS 272 H+RDY PKRR YSRSVSP+EKRYSRERSYS SP R+ S P++G R+RS+TPVR+ Sbjct: 153 HSRDY---SPKRRPYSRSVSPEEKRYSRERSYSRSPPRDLSPPPHNGSRSRSQTPVREH- 208 Query: 273 PPPFRG 290 PP+ G Sbjct: 209 -PPYNG 213 >ref|XP_006354141.1| PREDICTED: serine/arginine-rich splicing factor 33-like [Solanum tuberosum] Length = 248 Score = 79.7 bits (195), Expect = 7e-13 Identities = 42/66 (63%), Positives = 52/66 (78%), Gaps = 2/66 (3%) Frame = +3 Query: 99 HNRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERS--PYDGPRNRSRTPVRDQS 272 H+RDY PKRRQYSRSVSP+EKRYSRERSYS SP + S P++G R+RS+TPVR++ Sbjct: 153 HSRDY---SPKRRQYSRSVSPEEKRYSRERSYSRSPPCDLSPPPHNGSRSRSQTPVRER- 208 Query: 273 PPPFRG 290 PP+ G Sbjct: 209 -PPYNG 213 >emb|CBI16510.3| unnamed protein product [Vitis vinifera] Length = 269 Score = 79.3 bits (194), Expect = 9e-13 Identities = 39/62 (62%), Positives = 49/62 (79%), Gaps = 5/62 (8%) Frame = +3 Query: 105 RDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERS-----PYDGPRNRSRTPVRDQ 269 RDYYSP PKRRQYSRSVSPQ++RYSR+RSY+ R RS PY+G R+RS++P+R + Sbjct: 184 RDYYSPSPKRRQYSRSVSPQDRRYSRDRSYT-PDGRRRSYTRSPPYNGSRSRSQSPIRGE 242 Query: 270 SP 275 SP Sbjct: 243 SP 244 >ref|XP_002285703.1| PREDICTED: uncharacterized protein LOC100263951 [Vitis vinifera] Length = 245 Score = 79.3 bits (194), Expect = 9e-13 Identities = 39/62 (62%), Positives = 49/62 (79%), Gaps = 5/62 (8%) Frame = +3 Query: 105 RDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERS-----PYDGPRNRSRTPVRDQ 269 RDYYSP PKRRQYSRSVSPQ++RYSR+RSY+ R RS PY+G R+RS++P+R + Sbjct: 160 RDYYSPSPKRRQYSRSVSPQDRRYSRDRSYT-PDGRRRSYTRSPPYNGSRSRSQSPIRGE 218 Query: 270 SP 275 SP Sbjct: 219 SP 220 >ref|XP_004294999.1| PREDICTED: serine/arginine-rich splicing factor 33-like [Fragaria vesca subsp. vesca] Length = 261 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/64 (57%), Positives = 45/64 (70%) Frame = +3 Query: 102 NRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERSPYDGPRNRSRTPVRDQSPPP 281 +R Y SPPPKRR+YSRSVSP +RYSRERS+S SP R PY+G R S++PVR S Sbjct: 170 SRSYDSPPPKRREYSRSVSPPGRRYSRERSFSRSPPR---PYNGSRGHSQSPVRSPSRSR 226 Query: 282 FRGP 293 + P Sbjct: 227 SQSP 230 >ref|XP_006445639.1| hypothetical protein CICLE_v10016371mg [Citrus clementina] gi|568871469|ref|XP_006488908.1| PREDICTED: serine/arginine-rich splicing factor 33-like [Citrus sinensis] gi|568885431|ref|XP_006495277.1| PREDICTED: serine/arginine-rich splicing factor 33-like [Citrus sinensis] gi|557548250|gb|ESR58879.1| hypothetical protein CICLE_v10016371mg [Citrus clementina] Length = 253 Score = 73.6 bits (179), Expect = 5e-11 Identities = 42/69 (60%), Positives = 46/69 (66%), Gaps = 4/69 (5%) Frame = +3 Query: 99 HNRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERSPYDGPRNRSRTPVRDQ--- 269 + RDY SPPP+RR YSRSVSP + YSRERSYS SPA YDGPR RSR+P R Q Sbjct: 161 YGRDY-SPPPRRRNYSRSVSPHGQNYSRERSYSRSPA-----YDGPRGRSRSPHRGQRQS 214 Query: 270 -SPPPFRGP 293 SP R P Sbjct: 215 WSPSRSRTP 223 >ref|XP_002532060.1| serine/arginine rich splicing factor, putative [Ricinus communis] gi|223528264|gb|EEF30315.1| serine/arginine rich splicing factor, putative [Ricinus communis] Length = 246 Score = 72.0 bits (175), Expect = 1e-10 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 4/62 (6%) Frame = +3 Query: 102 NRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERSP----YDGPRNRSRTPVRDQ 269 + DY SPPPKRR YS+S+SPQ KRYS+ERSYS S +R R+P PR+RSRTP R + Sbjct: 162 SHDYGSPPPKRR-YSKSISPQGKRYSQERSYSRSRSRSRTPNRDQSQTPRSRSRTPNRSR 220 Query: 270 SP 275 SP Sbjct: 221 SP 222 >ref|XP_003544854.1| PREDICTED: serine/arginine-rich splicing factor 33 isoform 1 [Glycine max] Length = 249 Score = 71.2 bits (173), Expect = 3e-10 Identities = 40/72 (55%), Positives = 53/72 (73%), Gaps = 10/72 (13%) Frame = +3 Query: 102 NRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERS-----PYD-GPRNRSRTPVR 263 +RDYYSPP KRR+YSRSVSP+++RYSRERS+S +RERS PY+ G R+RS++P + Sbjct: 166 SRDYYSPPAKRREYSRSVSPEDRRYSRERSFSQH-SRERSYSRSPPYNGGSRSRSQSPAK 224 Query: 264 ----DQSPPPFR 287 +SP P R Sbjct: 225 GPGQSRSPSPNR 236 >gb|EMJ06950.1| hypothetical protein PRUPE_ppa010237mg [Prunus persica] Length = 258 Score = 70.1 bits (170), Expect = 6e-10 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 1/58 (1%) Frame = +3 Query: 102 NRDYYSPPPKRRQYSRSVS-PQEKRYSRERSYSHSPARERSPYDGPRNRSRTPVRDQS 272 + DYYSPPPKRR YSRSVS PQE+RYSRE+S+S SP PY G R+ S +P R S Sbjct: 167 SHDYYSPPPKRRDYSRSVSPPQERRYSREKSFSRSP----PPYKGSRSHSESPDRGPS 220 >ref|XP_006386054.1| hypothetical protein POPTR_0003s21240g [Populus trichocarpa] gi|550343691|gb|ERP63851.1| hypothetical protein POPTR_0003s21240g [Populus trichocarpa] Length = 245 Score = 67.8 bits (164), Expect = 3e-09 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 13/80 (16%) Frame = +3 Query: 99 HNRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERSPYDGP-------------R 239 H+RDYYSPP KRR SRSVSP+E+RYS+ERSYS S + ++P G + Sbjct: 164 HSRDYYSPP-KRRHPSRSVSPRERRYSQERSYSRSRSHSQTPNRGQIRSPVRSRSSSPRK 222 Query: 240 NRSRTPVRDQSPPPFRGPGS 299 +RSR+P+ D+ P G S Sbjct: 223 SRSRSPIHDEYPKEVNGDKS 242 >ref|XP_004502205.1| PREDICTED: serine/arginine-rich splicing factor 33-like isoform X2 [Cicer arietinum] gi|502135061|ref|XP_004502206.1| PREDICTED: serine/arginine-rich splicing factor 33-like isoform X3 [Cicer arietinum] Length = 206 Score = 67.8 bits (164), Expect = 3e-09 Identities = 36/66 (54%), Positives = 43/66 (65%) Frame = +3 Query: 99 HNRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERSPYDGPRNRSRTPVRDQSPP 278 H Y SPPPKRR+YSRSVSP+++R SRERSYS +RERS P N R +SP Sbjct: 122 HRSRYDSPPPKRREYSRSVSPEDRRRSRERSYSQH-SRERSYSHSPPNNGN--ARSRSPS 178 Query: 279 PFRGPG 296 P + PG Sbjct: 179 PVKDPG 184 >ref|XP_004502204.1| PREDICTED: serine/arginine-rich splicing factor 33-like isoform X1 [Cicer arietinum] Length = 243 Score = 67.8 bits (164), Expect = 3e-09 Identities = 36/66 (54%), Positives = 43/66 (65%) Frame = +3 Query: 99 HNRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERSPYDGPRNRSRTPVRDQSPP 278 H Y SPPPKRR+YSRSVSP+++R SRERSYS +RERS P N R +SP Sbjct: 159 HRSRYDSPPPKRREYSRSVSPEDRRRSRERSYSQH-SRERSYSHSPPNNGN--ARSRSPS 215 Query: 279 PFRGPG 296 P + PG Sbjct: 216 PVKDPG 221 >gb|ABK92507.1| unknown [Populus trichocarpa] Length = 149 Score = 67.8 bits (164), Expect = 3e-09 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 13/80 (16%) Frame = +3 Query: 99 HNRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERSPYDGP-------------R 239 H+RDYYSPP KRR SRSVSP+E+RYS+ERSYS S + ++P G + Sbjct: 68 HSRDYYSPP-KRRHPSRSVSPRERRYSQERSYSRSRSHSQTPNRGQIRSPVRSRSSSPRK 126 Query: 240 NRSRTPVRDQSPPPFRGPGS 299 +RSR+P+ D+ P G S Sbjct: 127 SRSRSPIHDEYPKEVNGDKS 146 >gb|ESW35836.1| hypothetical protein PHAVU_001G268900g [Phaseolus vulgaris] Length = 242 Score = 66.6 bits (161), Expect = 6e-09 Identities = 37/68 (54%), Positives = 50/68 (73%), Gaps = 6/68 (8%) Frame = +3 Query: 102 NRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERS-----PYD-GPRNRSRTPVR 263 +RDYYSPP KR +YSRS SP+++++SRERSYS +RERS PY+ G R+ ++ PVR Sbjct: 164 SRDYYSPP-KRTEYSRSASPEDRKFSRERSYSQH-SRERSYSRSPPYNGGSRSPAKAPVR 221 Query: 264 DQSPPPFR 287 +SP P R Sbjct: 222 SRSPSPDR 229 >ref|XP_003601611.1| Arginine/serine-rich splicing factor [Medicago truncatula] gi|355490659|gb|AES71862.1| Arginine/serine-rich splicing factor [Medicago truncatula] Length = 147 Score = 65.1 bits (157), Expect = 2e-08 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 11/73 (15%) Frame = +3 Query: 102 NRDYYSPPPKRRQYSRSVSPQEKR-------YSRERSYSHSPARERSPYDGPRNRSRTPV 260 +RDY+SPPPKRR+YSRSVSP+++R +SRERSYS SP + R+RS++PV Sbjct: 66 SRDYHSPPPKRREYSRSVSPEDRRHSREGSQHSRERSYSRSPPKN----GDARSRSQSPV 121 Query: 261 R----DQSPPPFR 287 + +SP P R Sbjct: 122 KGSVESRSPSPSR 134 >ref|XP_003601610.1| Arginine/serine-rich splicing factor [Medicago truncatula] gi|355490658|gb|AES71861.1| Arginine/serine-rich splicing factor [Medicago truncatula] gi|388503978|gb|AFK40055.1| unknown [Medicago truncatula] Length = 248 Score = 65.1 bits (157), Expect = 2e-08 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 11/73 (15%) Frame = +3 Query: 102 NRDYYSPPPKRRQYSRSVSPQEKR-------YSRERSYSHSPARERSPYDGPRNRSRTPV 260 +RDY+SPPPKRR+YSRSVSP+++R +SRERSYS SP + R+RS++PV Sbjct: 167 SRDYHSPPPKRREYSRSVSPEDRRHSREGSQHSRERSYSRSPPKN----GDARSRSQSPV 222 Query: 261 R----DQSPPPFR 287 + +SP P R Sbjct: 223 KGSVESRSPSPSR 235 >gb|ACU22994.1| unknown [Glycine max] Length = 214 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/49 (65%), Positives = 40/49 (81%), Gaps = 5/49 (10%) Frame = +3 Query: 102 NRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERS-----PYDG 233 +RDYYSPP KRR+YSRSVSP+++RYSRERS+S +RERS PY+G Sbjct: 166 SRDYYSPPAKRREYSRSVSPEDRRYSRERSFSQH-SRERSYSRSPPYNG 213 >ref|XP_006574390.1| PREDICTED: uncharacterized protein LOC100779321 isoform X1 [Glycine max] Length = 253 Score = 63.9 bits (154), Expect = 4e-08 Identities = 37/61 (60%), Positives = 46/61 (75%), Gaps = 6/61 (9%) Frame = +3 Query: 99 HNRDYYSPPPKRRQYSRSVSPQEKRYSRERSYSHSPARERS-----PYD-GPRNRSRTPV 260 H+RDYYSP KRR+YSRSVSP+ +RYSRERSYS RERS PY+ G R+RS++P Sbjct: 171 HSRDYYSP--KRREYSRSVSPEGRRYSRERSYSQH-NRERSFSRSPPYNGGSRSRSQSPA 227 Query: 261 R 263 + Sbjct: 228 K 228