BLASTX nr result
ID: Catharanthus22_contig00012928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00012928 (784 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002450418.1| hypothetical protein SORBIDRAFT_05g005061 [S... 59 1e-06 >ref|XP_002450418.1| hypothetical protein SORBIDRAFT_05g005061 [Sorghum bicolor] gi|241936261|gb|EES09406.1| hypothetical protein SORBIDRAFT_05g005061 [Sorghum bicolor] Length = 753 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/79 (36%), Positives = 46/79 (58%) Frame = -1 Query: 277 MRILSWNNCGLGMSTAITEL*NLCPDFRPHMLYIVETKLSSRQIIN*DCLLGFYSTFVVA 98 M+ L WN G+G + EL +L D+ P +++I+ET++S ++ N L F ++F V Sbjct: 1 MKTLCWNCRGIGNPATVKELRDLAKDYAPSVMFIMETQISKYRVENLRYTLSFDNSFAVN 60 Query: 97 SHRRSGGIAFLWINSVEMS 41 S RSGG+ W N V +S Sbjct: 61 SSGRSGGLGLFWNNDVLLS 79