BLASTX nr result
ID: Catharanthus22_contig00012629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00012629 (748 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69087.1| hypothetical protein VITISV_031061 [Vitis vinifera] 62 3e-07 >emb|CAN69087.1| hypothetical protein VITISV_031061 [Vitis vinifera] Length = 611 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/53 (56%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = -1 Query: 493 FSCCCAVSGKLCNLVI-GRQQENIVCQEMVDKLKLKIERNPWPYRILW*KVGH 338 F C GKLCN +I G EN+V QEMVDKLKLK+E++P PY ILW G+ Sbjct: 258 FRTSCTSGGKLCNFIIDGGSSENLVSQEMVDKLKLKMEKHPQPYCILWFNKGN 310