BLASTX nr result
ID: Catharanthus22_contig00012569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00012569 (303 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX95786.1| Arabinogalactan protein 20 [Theobroma cacao] 56 6e-06 >gb|EOX95786.1| Arabinogalactan protein 20 [Theobroma cacao] Length = 75 Score = 55.8 bits (133), Expect = 6e-06 Identities = 31/61 (50%), Positives = 38/61 (62%) Frame = +2 Query: 74 SGVFVRATAVFAIIAFILLXXXXXXXXXXXXXXXTSDGTSIDQGIAYLLMVVALALTYLI 253 S FV A+FA++ F ++ TSDGTSIDQGIAY+LM+VAL LTYLI Sbjct: 6 SRAFVGVMAIFALV-FAIVSPFVEAQSAAPAPSPTSDGTSIDQGIAYVLMLVALVLTYLI 64 Query: 254 H 256 H Sbjct: 65 H 65