BLASTX nr result
ID: Catharanthus22_contig00012541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00012541 (678 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ17676.1| hypothetical protein PRUPE_ppa026148mg [Prunus pe... 60 6e-07 >gb|EMJ17676.1| hypothetical protein PRUPE_ppa026148mg [Prunus persica] Length = 94 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = +3 Query: 375 PTKKLERKSTKDVNASAEAFIQKFXXXXXXXXXESIENYEQMLKRG 512 P KLERKST+D+N SAEAFI+KF ESIENYEQML RG Sbjct: 48 PKNKLERKSTEDINESAEAFIKKFRKQLLIQRLESIENYEQMLARG 93