BLASTX nr result
ID: Catharanthus22_contig00012375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00012375 (558 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1... 58 2e-06 ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [S... 57 2e-06 ref|XP_002269243.1| PREDICTED: mitochondrial import receptor sub... 56 7e-06 >ref|NP_001150221.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195606532|gb|ACG25096.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195637638|gb|ACG38287.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|195658849|gb|ACG48892.1| mitochondrial import receptor subunit TOM7-1 [Zea mays] gi|223945683|gb|ACN26925.1| unknown [Zea mays] gi|413950686|gb|AFW83335.1| import receptor subunit TOM7-1 [Zea mays] Length = 79 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/57 (45%), Positives = 37/57 (64%) Frame = +3 Query: 96 EDDGGSSPSTVKMLXXXXXXXXXXXXXXXHYGFIPLIIIIGMNSEPRPSWFHLLSPV 266 ++D ++ +TV+++ HYGFIPL+I+IGMNSEP+PS F LLSPV Sbjct: 23 DEDATAAATTVRLMKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >ref|XP_002458194.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] gi|241930169|gb|EES03314.1| hypothetical protein SORBIDRAFT_03g028510 [Sorghum bicolor] Length = 79 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/57 (45%), Positives = 37/57 (64%) Frame = +3 Query: 96 EDDGGSSPSTVKMLXXXXXXXXXXXXXXXHYGFIPLIIIIGMNSEPRPSWFHLLSPV 266 ++D ++ +TV+++ HYGFIPL+I+IGMNSEP+PS F LLSPV Sbjct: 23 DEDATAAATTVRLVKEWTTWTMKKAKVVAHYGFIPLVIVIGMNSEPKPSVFQLLSPV 79 >ref|XP_002269243.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Vitis vinifera] Length = 73 Score = 55.8 bits (133), Expect = 7e-06 Identities = 27/55 (49%), Positives = 31/55 (56%) Frame = +3 Query: 102 DGGSSPSTVKMLXXXXXXXXXXXXXXXHYGFIPLIIIIGMNSEPRPSWFHLLSPV 266 DG ST K L HYGFIP++IIIGMNSEP+P + LLSPV Sbjct: 19 DGSEGHSTAKCLKDWSNWALKKAKVITHYGFIPMVIIIGMNSEPKPQLYQLLSPV 73