BLASTX nr result
ID: Catharanthus22_contig00012037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00012037 (617 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGL91645.1| geranyl diphosphate synthase large subunit [Catha... 122 6e-26 gb|AEI53622.1| chloroplast geranylgeranyl diphosphate synthase [... 122 6e-26 sp|Q42698.1|GGPPS_CATRO RecName: Full=Geranylgeranyl pyrophospha... 74 3e-11 >gb|AGL91645.1| geranyl diphosphate synthase large subunit [Catharanthus roseus] Length = 383 Score = 122 bits (307), Expect = 6e-26 Identities = 60/65 (92%), Positives = 62/65 (95%) Frame = +1 Query: 373 MSFVNSITTWVPAQSICCLENGRSSSMRSNLCHPLKNQLPISFCLSGTIPKPIFSCSRVS 552 MSFVNSITTWVPAQSI CLENGRSSSMRSNLCHPLKNQLPISF LSGTI KPIFSCSR+S Sbjct: 1 MSFVNSITTWVPAQSIYCLENGRSSSMRSNLCHPLKNQLPISFFLSGTIRKPIFSCSRLS 60 Query: 553 ISAVI 567 ISA+I Sbjct: 61 ISAII 65 >gb|AEI53622.1| chloroplast geranylgeranyl diphosphate synthase [Catharanthus roseus] Length = 383 Score = 122 bits (307), Expect = 6e-26 Identities = 60/65 (92%), Positives = 62/65 (95%) Frame = +1 Query: 373 MSFVNSITTWVPAQSICCLENGRSSSMRSNLCHPLKNQLPISFCLSGTIPKPIFSCSRVS 552 MSFVNSITTWVPAQSI CLENGRSSSMRSNLCHPLKNQLPISF LSGTI KPIFSCSR+S Sbjct: 1 MSFVNSITTWVPAQSIYCLENGRSSSMRSNLCHPLKNQLPISFFLSGTIRKPIFSCSRLS 60 Query: 553 ISAVI 567 ISA+I Sbjct: 61 ISAII 65 >sp|Q42698.1|GGPPS_CATRO RecName: Full=Geranylgeranyl pyrophosphate synthase, chloroplastic; Short=GGPP synthase; Short=GGPS; AltName: Full=(2E,6E)-farnesyl diphosphate synthase; AltName: Full=Dimethylallyltranstransferase; AltName: Full=Farnesyl diphosphate synthase; AltName: Full=Farnesyltranstransferase; AltName: Full=Geranyltranstransferase; Flags: Precursor gi|1063276|emb|CAA63486.1| geranylgeranyl pyrophosphate synthase [Catharanthus roseus] Length = 357 Score = 73.9 bits (180), Expect = 3e-11 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 451 MRSNLCHPLKNQLPISFCLSGTIPKPIFSCSRVSISAVI 567 MRSNLCHPLKNQLPISF LSGTI KPIFSCSR+SISA+I Sbjct: 1 MRSNLCHPLKNQLPISFFLSGTIRKPIFSCSRLSISAII 39