BLASTX nr result
ID: Catharanthus22_contig00012026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00012026 (1164 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279835.1| PREDICTED: uncharacterized protein LOC100244... 58 8e-06 >ref|XP_002279835.1| PREDICTED: uncharacterized protein LOC100244623 [Vitis vinifera] Length = 401 Score = 57.8 bits (138), Expect = 8e-06 Identities = 29/44 (65%), Positives = 31/44 (70%), Gaps = 2/44 (4%) Frame = +3 Query: 861 DTEDDARYPPIPYGVNQP--YSSSSRQKVPSRNTSAFARNGNNH 986 DTEDDARYPP PYGVN P Y SS R K+P RNTS R GN + Sbjct: 3 DTEDDARYPPNPYGVNHPQGYGSSHRPKLPVRNTSYQRRIGNQY 46