BLASTX nr result
ID: Catharanthus22_contig00011984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00011984 (1044 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006416418.1| hypothetical protein EUTSA_v10009574mg [Eutr... 103 1e-19 gb|EOY15113.1| Pentatricopeptide repeat (PPR) superfamily protei... 102 2e-19 emb|CBI18929.3| unnamed protein product [Vitis vinifera] 102 2e-19 ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containi... 102 2e-19 ref|NP_173449.1| pentatricopeptide repeat-containing protein [Ar... 102 3e-19 ref|XP_002890375.1| pentatricopeptide repeat-containing protein ... 102 3e-19 ref|XP_006306841.1| hypothetical protein CARUB_v10008385mg [Caps... 101 6e-19 gb|EXB68664.1| hypothetical protein L484_024678 [Morus notabilis] 97 8e-18 gb|EPS74339.1| hypothetical protein M569_00411 [Genlisea aurea] 97 8e-18 ref|XP_002301973.2| pentatricopeptide repeat-containing family p... 96 2e-17 ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containi... 94 1e-16 ref|XP_003566320.1| PREDICTED: pentatricopeptide repeat-containi... 93 2e-16 ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containi... 93 2e-16 ref|XP_004250454.1| PREDICTED: pentatricopeptide repeat-containi... 92 3e-16 gb|EMS48015.1| hypothetical protein TRIUR3_15376 [Triticum urartu] 91 6e-16 ref|XP_006587447.1| PREDICTED: pentatricopeptide repeat-containi... 91 8e-16 ref|XP_004165812.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-15 ref|XP_004147229.1| PREDICTED: pentatricopeptide repeat-containi... 91 1e-15 gb|ESW24601.1| hypothetical protein PHAVU_004G144300g [Phaseolus... 90 1e-15 ref|XP_004515286.1| PREDICTED: pentatricopeptide repeat-containi... 90 1e-15 >ref|XP_006416418.1| hypothetical protein EUTSA_v10009574mg [Eutrema salsugineum] gi|557094189|gb|ESQ34771.1| hypothetical protein EUTSA_v10009574mg [Eutrema salsugineum] Length = 760 Score = 103 bits (257), Expect = 1e-19 Identities = 49/77 (63%), Positives = 56/77 (72%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++FGLLNT TPL V+KNLRICGDCH+VIKFISG+ EIFVRDT Sbjct: 692 HSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHSVIKFISGY--------AGREIFVRDT 743 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHFK+G+CSCGD W Sbjct: 744 NRFHHFKDGICSCGDFW 760 >gb|EOY15113.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 758 Score = 102 bits (254), Expect = 2e-19 Identities = 49/77 (63%), Positives = 55/77 (71%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L + FGLLNT P +PL ++KNLRICGDCHAVIKFISGF EI+VRDT Sbjct: 690 HSEKLAVAFGLLNTPPGSPLQIIKNLRICGDCHAVIKFISGF--------EGREIYVRDT 741 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHFK+GVCSC D W Sbjct: 742 NRFHHFKDGVCSCRDYW 758 >emb|CBI18929.3| unnamed protein product [Vitis vinifera] Length = 387 Score = 102 bits (254), Expect = 2e-19 Identities = 50/77 (64%), Positives = 53/77 (68%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++FGLLNT P PL V+KNLRICGDCH VIKFIS F EIFVRDT Sbjct: 319 HSEKLAVVFGLLNTPPGYPLQVIKNLRICGDCHVVIKFISSF--------ERREIFVRDT 370 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHFKEG CSCGD W Sbjct: 371 NRFHHFKEGACSCGDYW 387 >ref|XP_002284744.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vitis vinifera] Length = 758 Score = 102 bits (254), Expect = 2e-19 Identities = 50/77 (64%), Positives = 53/77 (68%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++FGLLNT P PL V+KNLRICGDCH VIKFIS F EIFVRDT Sbjct: 690 HSEKLAVVFGLLNTPPGYPLQVIKNLRICGDCHVVIKFISSF--------ERREIFVRDT 741 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHFKEG CSCGD W Sbjct: 742 NRFHHFKEGACSCGDYW 758 >ref|NP_173449.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|193806503|sp|Q9LNU6.2|PPR53_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At1g20230 gi|332191832|gb|AEE29953.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 760 Score = 102 bits (253), Expect = 3e-19 Identities = 48/77 (62%), Positives = 55/77 (71%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++FGLLNT TPL V+KNLRICGDCHAVIKFIS + EIF+RDT Sbjct: 692 HSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHAVIKFISSY--------AGREIFIRDT 743 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHFK+G+CSCGD W Sbjct: 744 NRFHHFKDGICSCGDFW 760 >ref|XP_002890375.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297336217|gb|EFH66634.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 760 Score = 102 bits (253), Expect = 3e-19 Identities = 48/77 (62%), Positives = 55/77 (71%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++FGLLNT TPL V+KNLRICGDCHAVIKFIS + EIF+RDT Sbjct: 692 HSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHAVIKFISSY--------AGREIFIRDT 743 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHFK+G+CSCGD W Sbjct: 744 NRFHHFKDGICSCGDFW 760 >ref|XP_006306841.1| hypothetical protein CARUB_v10008385mg [Capsella rubella] gi|482575552|gb|EOA39739.1| hypothetical protein CARUB_v10008385mg [Capsella rubella] Length = 760 Score = 101 bits (251), Expect = 6e-19 Identities = 48/77 (62%), Positives = 55/77 (71%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++FGLLNT TPL V+KNLRICGDCH+VIKFIS + EIFVRDT Sbjct: 692 HSEKLAVVFGLLNTPDGTPLQVIKNLRICGDCHSVIKFISSY--------AGREIFVRDT 743 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHFK+G+CSCGD W Sbjct: 744 NRFHHFKDGICSCGDFW 760 >gb|EXB68664.1| hypothetical protein L484_024678 [Morus notabilis] Length = 728 Score = 97.4 bits (241), Expect = 8e-18 Identities = 48/77 (62%), Positives = 52/77 (67%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L + FGLLNT P + L V+KNLRICGDCH VIKFIS F EIFVRDT Sbjct: 660 HSEKLAVAFGLLNTPPGSSLRVIKNLRICGDCHVVIKFISSF--------EQREIFVRDT 711 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHFK+G CSCGD W Sbjct: 712 NRFHHFKDGHCSCGDYW 728 >gb|EPS74339.1| hypothetical protein M569_00411 [Genlisea aurea] Length = 1063 Score = 97.4 bits (241), Expect = 8e-18 Identities = 46/77 (59%), Positives = 54/77 (70%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++FG+LNT +P+ V KNLRICGDCHAVIKFISGF EI VRDT Sbjct: 995 HSEKLAVVFGILNTSRGSPIRVTKNLRICGDCHAVIKFISGF--------EGREISVRDT 1046 Query: 573 ARFHHFKEGVCSCGDVW 523 R+HHFK+G+CSCGD W Sbjct: 1047 NRYHHFKDGICSCGDYW 1063 >ref|XP_002301973.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344115|gb|EEE81246.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 724 Score = 96.3 bits (238), Expect = 2e-17 Identities = 49/77 (63%), Positives = 52/77 (67%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++ GLLNTKP PL V+KNLRIC DCHAVIKFIS F EIFVRDT Sbjct: 656 HSEKLAVVLGLLNTKPGFPLQVIKNLRICRDCHAVIKFISDF--------EKREIFVRDT 707 Query: 573 ARFHHFKEGVCSCGDVW 523 RFH FK GVCSCGD W Sbjct: 708 NRFHQFKGGVCSCGDYW 724 >ref|XP_004292932.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Fragaria vesca subsp. vesca] Length = 755 Score = 93.6 bits (231), Expect = 1e-16 Identities = 46/77 (59%), Positives = 52/77 (67%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++ GLLNT P + L V+KNLRICGDCH+VIKFIS EI VRDT Sbjct: 687 HSEKLAVVLGLLNTPPGSSLRVIKNLRICGDCHSVIKFISSL--------EGREISVRDT 738 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHFK+GVCSCGD W Sbjct: 739 NRFHHFKDGVCSCGDYW 755 >ref|XP_003566320.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Brachypodium distachyon] Length = 661 Score = 93.2 bits (230), Expect = 2e-16 Identities = 44/80 (55%), Positives = 53/80 (66%) Frame = -1 Query: 762 IKMHPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFV 583 + +H L + GL++T+P TPL V+KNLRICGDCH +KFIS F EI V Sbjct: 590 LAVHSEKLAVALGLISTRPGTPLRVIKNLRICGDCHEAMKFISSF--------EQREISV 641 Query: 582 RDTARFHHFKEGVCSCGDVW 523 RDT RFHHFK+G CSCGD W Sbjct: 642 RDTNRFHHFKDGKCSCGDYW 661 >ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like isoform X1 [Glycine max] Length = 748 Score = 93.2 bits (230), Expect = 2e-16 Identities = 46/77 (59%), Positives = 51/77 (66%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++ GLLNT P PL V+KNLRIC DCHAVIK IS EI+VRDT Sbjct: 680 HSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVIS--------RLEGREIYVRDT 731 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHFK+GVCSCGD W Sbjct: 732 NRFHHFKDGVCSCGDFW 748 >ref|XP_004250454.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Solanum lycopersicum] Length = 828 Score = 92.4 bits (228), Expect = 3e-16 Identities = 43/77 (55%), Positives = 50/77 (64%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++ G+LNT P T L V+KNLRICGDCH IKFIS F EI+VRD Sbjct: 760 HSEKLAVVLGILNTNPGTSLRVIKNLRICGDCHTFIKFISSF--------EGREIYVRDA 811 Query: 573 ARFHHFKEGVCSCGDVW 523 R+HHF EG+CSCGD W Sbjct: 812 NRYHHFNEGICSCGDYW 828 >gb|EMS48015.1| hypothetical protein TRIUR3_15376 [Triticum urartu] Length = 662 Score = 91.3 bits (225), Expect = 6e-16 Identities = 44/80 (55%), Positives = 52/80 (65%) Frame = -1 Query: 762 IKMHPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFV 583 + +H L + GL++T P TPL V+KNLRICGDCH +KFIS F EI V Sbjct: 591 LAVHSEKLAVALGLISTSPGTPLRVIKNLRICGDCHEAMKFISCF--------EGREISV 642 Query: 582 RDTARFHHFKEGVCSCGDVW 523 RDT RFHHFK+G CSCGD W Sbjct: 643 RDTNRFHHFKDGKCSCGDYW 662 >ref|XP_006587447.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Glycine max] Length = 601 Score = 90.9 bits (224), Expect = 8e-16 Identities = 45/77 (58%), Positives = 50/77 (64%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++ GLLNT P PL V+KNLRIC DCHAVIK IS EI+VRDT Sbjct: 533 HSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVIS--------RLEGREIYVRDT 584 Query: 573 ARFHHFKEGVCSCGDVW 523 R HHFK+GVCSCGD W Sbjct: 585 NRLHHFKDGVCSCGDFW 601 >ref|XP_004165812.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cucumis sativus] Length = 667 Score = 90.5 bits (223), Expect = 1e-15 Identities = 43/77 (55%), Positives = 47/77 (61%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L I FGL+ T P TP+ V KNLR+CGDCH IKFIS EI VRDT Sbjct: 599 HSEKLAIAFGLMKTAPGTPIRVFKNLRVCGDCHRAIKFISAI--------EKREIIVRDT 650 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHF+ G CSCGD W Sbjct: 651 TRFHHFRNGFCSCGDYW 667 >ref|XP_004147229.1| PREDICTED: pentatricopeptide repeat-containing protein At4g16835, mitochondrial-like [Cucumis sativus] Length = 667 Score = 90.5 bits (223), Expect = 1e-15 Identities = 43/77 (55%), Positives = 47/77 (61%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L I FGL+ T P TP+ V KNLR+CGDCH IKFIS EI VRDT Sbjct: 599 HSEKLAIAFGLMKTAPGTPIRVFKNLRVCGDCHRAIKFISAI--------EKREIIVRDT 650 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHF+ G CSCGD W Sbjct: 651 TRFHHFRNGFCSCGDYW 667 >gb|ESW24601.1| hypothetical protein PHAVU_004G144300g [Phaseolus vulgaris] Length = 601 Score = 90.1 bits (222), Expect = 1e-15 Identities = 44/77 (57%), Positives = 50/77 (64%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++ GLLNT P PL V+KNLRIC DCHAVIK IS EI++RDT Sbjct: 533 HSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKAIS--------RLEGREIYIRDT 584 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHH K+GVCSCGD W Sbjct: 585 NRFHHIKDGVCSCGDFW 601 >ref|XP_004515286.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like [Cicer arietinum] Length = 730 Score = 90.1 bits (222), Expect = 1e-15 Identities = 45/77 (58%), Positives = 50/77 (64%) Frame = -1 Query: 753 HPNFLNILFGLLNTKPSTPLTVLKNLRICGDCHAVIKFISGFXXXXXXXXXXXEIFVRDT 574 H L ++ GLLNT P PL V+KNLRIC DCHAVIK IS EI+VRDT Sbjct: 662 HSEKLAVVLGLLNTSPGQPLQVIKNLRICDDCHAVIKVIS--------RLEAREIYVRDT 713 Query: 573 ARFHHFKEGVCSCGDVW 523 RFHHFK+GVCSC D W Sbjct: 714 NRFHHFKDGVCSCEDFW 730