BLASTX nr result
ID: Catharanthus22_contig00011394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00011394 (570 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB02905.1| cytochrome b-c1 complex subunit 8 [Jatropha curcas] 64 4e-08 ref|XP_002263013.1| PREDICTED: cytochrome b-c1 complex subunit 8... 62 8e-08 ref|XP_006286608.1| hypothetical protein CARUB_v10002333mg [Caps... 62 1e-07 ref|XP_002264389.1| PREDICTED: cytochrome b-c1 complex subunit 8... 61 2e-07 gb|EOY20209.1| Cytochrome b-c1 complex subunit 8 [Theobroma cacao] 60 3e-07 ref|XP_006399001.1| hypothetical protein EUTSA_v10015196mg [Eutr... 60 4e-07 ref|XP_006398977.1| hypothetical protein EUTSA_v10015197mg [Eutr... 60 4e-07 ref|XP_002325629.1| ubiquinol-cytochrome C reductase complex ubi... 60 4e-07 ref|XP_004142978.1| PREDICTED: cytochrome b-c1 complex subunit 8... 59 9e-07 ref|XP_002533341.1| Ubiquinol-cytochrome c reductase complex ubi... 59 9e-07 ref|XP_006407498.1| hypothetical protein EUTSA_v10021877mg [Eutr... 59 1e-06 ref|XP_006298820.1| hypothetical protein CARUB_v10014926mg [Caps... 58 1e-06 gb|EMJ24638.1| hypothetical protein PRUPE_ppa014372mg [Prunus pe... 58 1e-06 ref|XP_003519298.1| PREDICTED: cytochrome b-c1 complex subunit 8... 58 1e-06 ref|NP_187697.1| Cytochrome b-c1 complex, subunit 8 protein [Ara... 58 1e-06 ref|XP_006451502.1| hypothetical protein CICLE_v10010097mg [Citr... 58 2e-06 ref|NP_196156.1| Cytochrome b-c1 complex, subunit 8 protein [Ara... 58 2e-06 ref|XP_004294709.1| PREDICTED: cytochrome b-c1 complex subunit 8... 57 3e-06 ref|XP_002319981.1| predicted protein [Populus trichocarpa] 57 3e-06 gb|EPS57976.1| hypothetical protein M569_16841 [Genlisea aurea] 57 3e-06 >gb|ADB02905.1| cytochrome b-c1 complex subunit 8 [Jatropha curcas] Length = 72 Score = 63.5 bits (153), Expect = 4e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW+SA LLLTP+IGTYT+ QNY+EKEKLEHRF Sbjct: 39 SENWISATLLLTPLIGTYTHVQNYQEKEKLEHRF 72 >ref|XP_002263013.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Vitis vinifera] gi|297737194|emb|CBI26395.3| unnamed protein product [Vitis vinifera] Length = 72 Score = 62.4 bits (150), Expect = 8e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 TENW+SA LLL P+IGTY+Y QNY+EKEKLEHR+ Sbjct: 39 TENWISATLLLAPLIGTYSYVQNYQEKEKLEHRY 72 >ref|XP_006286608.1| hypothetical protein CARUB_v10002333mg [Capsella rubella] gi|482555314|gb|EOA19506.1| hypothetical protein CARUB_v10002333mg [Capsella rubella] Length = 97 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW+S ILLL PVIGTY+YAQ YRE+EKLEHRF Sbjct: 64 SENWISTILLLAPVIGTYSYAQYYREQEKLEHRF 97 >ref|XP_002264389.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Vitis vinifera] gi|297745740|emb|CBI15796.3| unnamed protein product [Vitis vinifera] Length = 72 Score = 61.2 bits (147), Expect = 2e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 T+NW+SA LLL P++GTYTY QN++EKEKLEHR+ Sbjct: 39 TDNWISATLLLAPLVGTYTYVQNFKEKEKLEHRY 72 >gb|EOY20209.1| Cytochrome b-c1 complex subunit 8 [Theobroma cacao] Length = 72 Score = 60.5 bits (145), Expect = 3e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 TENW+SA LLL P++GTYTY QNY+EKEKL HR+ Sbjct: 39 TENWISATLLLGPLVGTYTYVQNYQEKEKLAHRY 72 >ref|XP_006399001.1| hypothetical protein EUTSA_v10015196mg [Eutrema salsugineum] gi|557100091|gb|ESQ40454.1| hypothetical protein EUTSA_v10015196mg [Eutrema salsugineum] Length = 72 Score = 60.1 bits (144), Expect = 4e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW+S ILLL PV+GTY+YAQ Y+E+EKLEHRF Sbjct: 39 SENWISTILLLAPVVGTYSYAQYYQEQEKLEHRF 72 >ref|XP_006398977.1| hypothetical protein EUTSA_v10015197mg [Eutrema salsugineum] gi|557100067|gb|ESQ40430.1| hypothetical protein EUTSA_v10015197mg [Eutrema salsugineum] Length = 72 Score = 60.1 bits (144), Expect = 4e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW+S ILLL PVIGTY+YAQ+++E+EKLEHRF Sbjct: 39 SENWISTILLLAPVIGTYSYAQHFQEQEKLEHRF 72 >ref|XP_002325629.1| ubiquinol-cytochrome C reductase complex ubiquinone-binding family protein [Populus trichocarpa] gi|118484575|gb|ABK94161.1| unknown [Populus trichocarpa] gi|118487047|gb|ABK95354.1| unknown [Populus trichocarpa] gi|222862504|gb|EEF00011.1| ubiquinol-cytochrome C reductase complex ubiquinone-binding family protein [Populus trichocarpa] Length = 72 Score = 60.1 bits (144), Expect = 4e-07 Identities = 24/34 (70%), Positives = 30/34 (88%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW+SA LLL P++G YTY QNY+EKEKLEHR+ Sbjct: 39 SENWISATLLLAPLVGVYTYVQNYQEKEKLEHRY 72 >ref|XP_004142978.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Cucumis sativus] gi|449500324|ref|XP_004161066.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Cucumis sativus] Length = 72 Score = 58.9 bits (141), Expect = 9e-07 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW+SA LL+TPV+G+YTY Q Y+EKEKL HR+ Sbjct: 39 SENWISAALLITPVVGSYTYVQQYKEKEKLSHRY 72 >ref|XP_002533341.1| Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, putative [Ricinus communis] gi|223526821|gb|EEF29040.1| Ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C, putative [Ricinus communis] Length = 92 Score = 58.9 bits (141), Expect = 9e-07 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF*DPEMESVII 439 +ENW+SA LLL P++G Y+Y QNY+EKEKLEHR + SVII Sbjct: 32 SENWISATLLLAPLVGVYSYVQNYQEKEKLEHRKPNALFYSVII 75 >ref|XP_006407498.1| hypothetical protein EUTSA_v10021877mg [Eutrema salsugineum] gi|557108644|gb|ESQ48951.1| hypothetical protein EUTSA_v10021877mg [Eutrema salsugineum] Length = 72 Score = 58.5 bits (140), Expect = 1e-06 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW+SA LL+TPV+GTY YAQ+++E+EKLEHRF Sbjct: 39 SENWISATLLVTPVLGTYWYAQHFQEQEKLEHRF 72 >ref|XP_006298820.1| hypothetical protein CARUB_v10014926mg [Capsella rubella] gi|482567529|gb|EOA31718.1| hypothetical protein CARUB_v10014926mg [Capsella rubella] Length = 125 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW+SA LL+TPV+GTY YAQ ++E+EKLEHRF Sbjct: 92 SENWISATLLVTPVVGTYWYAQYFKEQEKLEHRF 125 >gb|EMJ24638.1| hypothetical protein PRUPE_ppa014372mg [Prunus persica] Length = 72 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENWLSA LLL P++ TYTY Q Y+EKEKLEHR+ Sbjct: 39 SENWLSATLLLAPLVATYTYVQQYQEKEKLEHRY 72 >ref|XP_003519298.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Glycine max] Length = 72 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW+SA LLL P++GTYTY QNY EKEKL HR+ Sbjct: 39 SENWISATLLLGPLVGTYTYVQNYLEKEKLSHRY 72 >ref|NP_187697.1| Cytochrome b-c1 complex, subunit 8 protein [Arabidopsis thaliana] gi|6630544|gb|AAF19563.1|AC011708_6 putative ubiquinol-cytochrome C reductase complex ubiquinone-binding protein (QP-C) [Arabidopsis thaliana] gi|21592487|gb|AAM64437.1| putative ubiquinol-cytochrome C reductase complex ubiquinone-binding protein (QP-C) [Arabidopsis thaliana] gi|23306448|gb|AAN17451.1| putative ubiquinol-cytochrome C reductase complex ubiquinone-binding protein (QP-C) [Arabidopsis thaliana] gi|30102794|gb|AAP21315.1| At3g10860 [Arabidopsis thaliana] gi|332641443|gb|AEE74964.1| Cytochrome b-c1 complex, subunit 8 protein [Arabidopsis thaliana] Length = 72 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW+SA LL+TPV+GTY YAQ ++E+EKLEHRF Sbjct: 39 SENWISATLLVTPVVGTYWYAQYFKEQEKLEHRF 72 >ref|XP_006451502.1| hypothetical protein CICLE_v10010097mg [Citrus clementina] gi|557554728|gb|ESR64742.1| hypothetical protein CICLE_v10010097mg [Citrus clementina] Length = 72 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 T+NW+S ILLL P++GTY Y QNY+EKEKL HR+ Sbjct: 39 TDNWISTILLLGPLVGTYAYVQNYQEKEKLAHRY 72 >ref|NP_196156.1| Cytochrome b-c1 complex, subunit 8 protein [Arabidopsis thaliana] gi|297810649|ref|XP_002873208.1| hypothetical protein ARALYDRAFT_487332 [Arabidopsis lyrata subsp. lyrata] gi|10176749|dbj|BAB09980.1| ubiquinol-cytochrome C reductase complex ubiquinone-binding protein [Arabidopsis thaliana] gi|34365575|gb|AAQ65099.1| At5g05370 [Arabidopsis thaliana] gi|297319045|gb|EFH49467.1| hypothetical protein ARALYDRAFT_487332 [Arabidopsis lyrata subsp. lyrata] gi|332003483|gb|AED90866.1| Cytochrome b-c1 complex, subunit 8 protein [Arabidopsis thaliana] Length = 72 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW+S ILL+ PV+GTY+YAQ ++E+EKLEHRF Sbjct: 39 SENWISTILLVAPVVGTYSYAQYFKEQEKLEHRF 72 >ref|XP_004294709.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Fragaria vesca subsp. vesca] Length = 72 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW SAI + PV+GTY Y QNY+EKEKLEHRF Sbjct: 39 SENWHSAIFAVGPVVGTYAYVQNYKEKEKLEHRF 72 >ref|XP_002319981.1| predicted protein [Populus trichocarpa] Length = 72 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENW+SA LLL P++G YTY QNY+EKEKL HR+ Sbjct: 39 SENWISATLLLGPLVGVYTYVQNYQEKEKLSHRY 72 >gb|EPS57976.1| hypothetical protein M569_16841 [Genlisea aurea] Length = 72 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = -1 Query: 570 TENWLSAILLLTPVIGTYTYAQNYREKEKLEHRF 469 +ENWLSA LLLTP++GTY+Y + Y+EKEK+EHR+ Sbjct: 39 SENWLSATLLLTPLVGTYSYVKWYQEKEKMEHRY 72