BLASTX nr result
ID: Catharanthus22_contig00011392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00011392 (298 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006364616.1| PREDICTED: ADP-ribosylation factor-like prot... 86 7e-15 ref|XP_004250173.1| PREDICTED: ADP-ribosylation factor-like prot... 86 7e-15 ref|XP_002531018.1| ADP-ribosylation factor, putative [Ricinus c... 86 7e-15 ref|XP_006482114.1| PREDICTED: ADP-ribosylation factor-like prot... 84 1e-14 ref|XP_006430594.1| hypothetical protein CICLE_v10012882mg [Citr... 84 1e-14 gb|EMJ16239.1| hypothetical protein PRUPE_ppa012069mg [Prunus pe... 84 1e-14 gb|EOY04367.1| ADP-ribosylation factor-like A1A [Theobroma cacao] 84 2e-14 dbj|BAL44265.1| ADP-ribosylation factor-like 8d [Nicotiana tabacum] 84 3e-14 ref|XP_004490821.1| PREDICTED: ADP-ribosylation factor-like prot... 83 3e-14 ref|NP_001237248.1| uncharacterized protein LOC100305570 [Glycin... 83 3e-14 ref|XP_003544985.1| PREDICTED: ADP-ribosylation factor-like prot... 82 6e-14 ref|XP_004953827.1| PREDICTED: ADP-ribosylation factor-like prot... 82 7e-14 ref|XP_006828540.1| hypothetical protein AMTR_s00060p00209750 [A... 82 1e-13 gb|AFW73276.1| hypothetical protein ZEAMMB73_186672 [Zea mays] 82 1e-13 gb|ACN26987.1| unknown [Zea mays] gi|413938726|gb|AFW73277.1| hy... 82 1e-13 ref|XP_002302942.1| predicted protein [Populus trichocarpa] gi|5... 82 1e-13 ref|XP_006284596.1| hypothetical protein CARUB_v10005828mg [Caps... 81 1e-13 gb|EMT02360.1| ADP-ribosylation factor-like protein 8B-A [Aegilo... 81 1e-13 ref|XP_003616274.1| ADP-ribosylation factor-like protein [Medica... 81 1e-13 emb|CAE54275.1| putative ADP-rybosylation factor-like protein [T... 81 1e-13 >ref|XP_006364616.1| PREDICTED: ADP-ribosylation factor-like protein 8B-A-like [Solanum tuberosum] Length = 129 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGLDSITDREVCCYMISCK+S+NID VIDWLIKHSKTAK Sbjct: 89 DQLGLDSITDREVCCYMISCKDSVNIDAVIDWLIKHSKTAK 129 >ref|XP_004250173.1| PREDICTED: ADP-ribosylation factor-like protein 8B-A-like [Solanum lycopersicum] Length = 184 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGLDSITDREVCCYMISCK+S+NID VIDWLIKHSKTAK Sbjct: 144 DQLGLDSITDREVCCYMISCKDSVNIDAVIDWLIKHSKTAK 184 >ref|XP_002531018.1| ADP-ribosylation factor, putative [Ricinus communis] gi|223529416|gb|EEF31378.1| ADP-ribosylation factor, putative [Ricinus communis] Length = 184 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGL+SITDREVCCYMISCK+S+NIDVVIDWLIKHSKTAK Sbjct: 144 DQLGLESITDREVCCYMISCKDSVNIDVVIDWLIKHSKTAK 184 >ref|XP_006482114.1| PREDICTED: ADP-ribosylation factor-like protein 8B-like isoform X1 [Citrus sinensis] Length = 184 Score = 84.3 bits (207), Expect = 1e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGL+SITDREVCCYMISCK+SINID VIDWLIKHSKTAK Sbjct: 144 DQLGLESITDREVCCYMISCKDSINIDAVIDWLIKHSKTAK 184 >ref|XP_006430594.1| hypothetical protein CICLE_v10012882mg [Citrus clementina] gi|557532651|gb|ESR43834.1| hypothetical protein CICLE_v10012882mg [Citrus clementina] Length = 184 Score = 84.3 bits (207), Expect = 1e-14 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGL+SITDREVCCYMISCK+SINID VIDWLIKHSKTAK Sbjct: 144 DQLGLESITDREVCCYMISCKDSINIDAVIDWLIKHSKTAK 184 >gb|EMJ16239.1| hypothetical protein PRUPE_ppa012069mg [Prunus persica] Length = 184 Score = 84.3 bits (207), Expect = 1e-14 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTA 121 DQLGLDSITD+EVCCYMISCK+SINIDVVIDWLIKHSKTA Sbjct: 144 DQLGLDSITDKEVCCYMISCKDSINIDVVIDWLIKHSKTA 183 >gb|EOY04367.1| ADP-ribosylation factor-like A1A [Theobroma cacao] Length = 373 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGL+S+TDREVCCYMISCK+S+NIDVVIDWLIKHS+TAK Sbjct: 333 DQLGLESVTDREVCCYMISCKDSVNIDVVIDWLIKHSRTAK 373 >dbj|BAL44265.1| ADP-ribosylation factor-like 8d [Nicotiana tabacum] Length = 184 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGLDS TDREVCCYMISCK+S+NID VIDWLIKHSKTAK Sbjct: 144 DQLGLDSTTDREVCCYMISCKDSVNIDAVIDWLIKHSKTAK 184 >ref|XP_004490821.1| PREDICTED: ADP-ribosylation factor-like protein 8B-like [Cicer arietinum] Length = 184 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGL+SI DREVCCYMISCK+S+NIDVVIDWLIKHSKTAK Sbjct: 144 DQLGLESIKDREVCCYMISCKDSVNIDVVIDWLIKHSKTAK 184 >ref|NP_001237248.1| uncharacterized protein LOC100305570 [Glycine max] gi|255625945|gb|ACU13317.1| unknown [Glycine max] Length = 184 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGL+SI DREVCCYMISCK+S+NIDVVIDWLIKHSKTAK Sbjct: 144 DQLGLESIKDREVCCYMISCKDSVNIDVVIDWLIKHSKTAK 184 >ref|XP_003544985.1| PREDICTED: ADP-ribosylation factor-like protein 8B-like [Glycine max] Length = 184 Score = 82.4 bits (202), Expect = 6e-14 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGL+SI DREVCCYMISCK+S+N+DVVIDWLIKHSKTAK Sbjct: 144 DQLGLESIKDREVCCYMISCKDSVNLDVVIDWLIKHSKTAK 184 >ref|XP_004953827.1| PREDICTED: ADP-ribosylation factor-like protein 8A-like [Setaria italica] Length = 332 Score = 82.0 bits (201), Expect = 7e-14 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGL+SI DREVCCYMISCK+S+NIDVVIDWLIKHS+TAK Sbjct: 292 DQLGLESIQDREVCCYMISCKDSVNIDVVIDWLIKHSRTAK 332 >ref|XP_006828540.1| hypothetical protein AMTR_s00060p00209750 [Amborella trichopoda] gi|548833288|gb|ERM95956.1| hypothetical protein AMTR_s00060p00209750 [Amborella trichopoda] Length = 298 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLG+D+I DREVCCYMISCK+SINID VIDWLIKHSKTAK Sbjct: 258 DQLGIDAIKDREVCCYMISCKDSINIDTVIDWLIKHSKTAK 298 >gb|AFW73276.1| hypothetical protein ZEAMMB73_186672 [Zea mays] Length = 195 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGL+SI DREVCCYMISCK+S+NID+VIDWLIKHS+TAK Sbjct: 155 DQLGLESIKDREVCCYMISCKDSVNIDIVIDWLIKHSRTAK 195 >gb|ACN26987.1| unknown [Zea mays] gi|413938726|gb|AFW73277.1| hypothetical protein ZEAMMB73_186672 [Zea mays] Length = 184 Score = 81.6 bits (200), Expect = 1e-13 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGL+SI DREVCCYMISCK+S+NID+VIDWLIKHS+TAK Sbjct: 144 DQLGLESIKDREVCCYMISCKDSVNIDIVIDWLIKHSRTAK 184 >ref|XP_002302942.1| predicted protein [Populus trichocarpa] gi|566210977|ref|XP_006372562.1| hypothetical protein POPTR_0017s02830g [Populus trichocarpa] gi|550319191|gb|ERP50359.1| hypothetical protein POPTR_0017s02830g [Populus trichocarpa] Length = 188 Score = 81.6 bits (200), Expect = 1e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTA 121 DQLGL+SITDREVCCYMISCK+S NID+VIDWLIKHSKTA Sbjct: 144 DQLGLESITDREVCCYMISCKDSTNIDIVIDWLIKHSKTA 183 >ref|XP_006284596.1| hypothetical protein CARUB_v10005828mg [Capsella rubella] gi|482553301|gb|EOA17494.1| hypothetical protein CARUB_v10005828mg [Capsella rubella] Length = 184 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTAK 124 DQLGL+SI DREVCCYMISCK+SINID VIDWLIKHS+TAK Sbjct: 144 DQLGLESIADREVCCYMISCKDSINIDAVIDWLIKHSRTAK 184 >gb|EMT02360.1| ADP-ribosylation factor-like protein 8B-A [Aegilops tauschii] Length = 172 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTA 121 DQLGL+SI DREVCCYMISCK+S+NIDVVIDWLIKHSKTA Sbjct: 132 DQLGLESIKDREVCCYMISCKDSVNIDVVIDWLIKHSKTA 171 >ref|XP_003616274.1| ADP-ribosylation factor-like protein [Medicago truncatula] gi|355517609|gb|AES99232.1| ADP-ribosylation factor-like protein [Medicago truncatula] gi|388507258|gb|AFK41695.1| unknown [Medicago truncatula] gi|388510186|gb|AFK43159.1| unknown [Medicago truncatula] Length = 184 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTA 121 DQLGL+SI DREVCCYMISCK+S+NIDVVIDWLIKHSKTA Sbjct: 144 DQLGLESIKDREVCCYMISCKDSVNIDVVIDWLIKHSKTA 183 >emb|CAE54275.1| putative ADP-rybosylation factor-like protein [Triticum aestivum] Length = 74 Score = 81.3 bits (199), Expect = 1e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = +2 Query: 2 DQLGLDSITDREVCCYMISCKESINIDVVIDWLIKHSKTA 121 DQLGL+SI DREVCCYMISCK+S+NIDVVIDWLIKHSKTA Sbjct: 34 DQLGLESIKDREVCCYMISCKDSVNIDVVIDWLIKHSKTA 73