BLASTX nr result
ID: Catharanthus22_contig00011216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00011216 (362 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359603.1| PREDICTED: NADP-dependent D-sorbitol-6-phosp... 59 3e-07 >ref|XP_006359603.1| PREDICTED: NADP-dependent D-sorbitol-6-phosphate dehydrogenase-like [Solanum tuberosum] Length = 309 Score = 59.3 bits (142), Expect(2) = 3e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 345 LERVMENFGALNFELTEEDMDVIKTMDGNYRTNQPA 238 LER+ ENF L+FELT+EDMD+IK++D NYRTNQPA Sbjct: 265 LERLQENFNVLDFELTKEDMDLIKSLDRNYRTNQPA 300 Score = 20.8 bits (42), Expect(2) = 3e-07 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -1 Query: 245 NLPAQFWGV 219 N PA+FWG+ Sbjct: 297 NQPAKFWGI 305