BLASTX nr result
ID: Catharanthus22_contig00010839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00010839 (232 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78944.1| hypothetical protein (mitochondrion) [Vicia faba] 54 1e-15 ref|XP_003588326.1| ATP synthase subunit alpha [Medicago truncat... 54 3e-15 gb|EXB92316.1| hypothetical protein L484_004636 [Morus notabilis] 60 3e-07 ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 59 5e-07 >gb|AGC78944.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 134 Score = 54.3 bits (129), Expect(2) = 1e-15 Identities = 31/49 (63%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Frame = -1 Query: 232 LAAIKLKR*LESAS--KGAGYLLTDSTATCWHXXXXXXXXXXXXAHFGC 92 LAAIK +R LESAS KGAG LLTDSTATCWH AHFGC Sbjct: 56 LAAIKKQRTLESASNSKGAGSLLTDSTATCWHSISSAGASLGSSAHFGC 104 Score = 54.3 bits (129), Expect(2) = 1e-15 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 81 LRRMSQQHKTRVSLVIGLDQTSHDTS 4 LRRMSQQHKTRVSLVIGLDQTSHDTS Sbjct: 109 LRRMSQQHKTRVSLVIGLDQTSHDTS 134 >ref|XP_003588326.1| ATP synthase subunit alpha [Medicago truncatula] gi|355477374|gb|AES58577.1| ATP synthase subunit alpha [Medicago truncatula] Length = 1116 Score = 54.3 bits (129), Expect(2) = 3e-15 Identities = 31/49 (63%), Positives = 32/49 (65%), Gaps = 2/49 (4%) Frame = -1 Query: 232 LAAIKLKR*LESAS--KGAGYLLTDSTATCWHXXXXXXXXXXXXAHFGC 92 LAAIK +R LESAS KGAG LLTDSTATCWH AHFGC Sbjct: 766 LAAIKKQRTLESASNSKGAGSLLTDSTATCWHSISSAGASLGSSAHFGC 814 Score = 52.8 bits (125), Expect(2) = 3e-15 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 81 LRRMSQQHKTRVSLVIGLDQTSHDT 7 LRRMSQQHKTRVSLVIGLDQTSHDT Sbjct: 819 LRRMSQQHKTRVSLVIGLDQTSHDT 843 >gb|EXB92316.1| hypothetical protein L484_004636 [Morus notabilis] Length = 202 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 1 SARVVRCLVKSYNERNPRFVLLRHAPKAAKGNR 99 SARVVRCLVKSYNERNPRFVLLRHAPK G R Sbjct: 78 SARVVRCLVKSYNERNPRFVLLRHAPKEMVGFR 110 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/54 (59%), Positives = 35/54 (64%), Gaps = 12/54 (22%) Frame = +1 Query: 1 SARVVRCLVKSYNERNPRFVLLRHAPK------------AAKGNRSEPRSRVTC 126 SARVVRCLVKSYNERNPRFVLLRHAPK A+K + RS + C Sbjct: 322 SARVVRCLVKSYNERNPRFVLLRHAPKEKVFATEVSRGLASKKTDARTRSSIPC 375