BLASTX nr result
ID: Catharanthus22_contig00010265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00010265 (300 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB80292.1| CCR4-NOT transcription complex subunit 3 [Morus n... 67 2e-09 ref|XP_006650361.1| PREDICTED: general negative regulator of tra... 67 2e-09 ref|XP_006348030.1| PREDICTED: general negative regulator of tra... 67 2e-09 ref|XP_006348029.1| PREDICTED: general negative regulator of tra... 67 2e-09 ref|XP_006443392.1| hypothetical protein CICLE_v10018788mg [Citr... 67 2e-09 ref|XP_006443391.1| hypothetical protein CICLE_v10018788mg [Citr... 67 2e-09 ref|XP_006443390.1| hypothetical protein CICLE_v10018788mg [Citr... 67 2e-09 ref|XP_006443389.1| hypothetical protein CICLE_v10018788mg [Citr... 67 2e-09 ref|XP_006443388.1| hypothetical protein CICLE_v10018788mg [Citr... 67 2e-09 ref|XP_006443387.1| hypothetical protein CICLE_v10018788mg [Citr... 67 2e-09 ref|XP_006443386.1| hypothetical protein CICLE_v10018788mg [Citr... 67 2e-09 ref|XP_006443385.1| hypothetical protein CICLE_v10018788mg [Citr... 67 2e-09 ref|XP_006443384.1| hypothetical protein CICLE_v10018788mg [Citr... 67 2e-09 ref|XP_006443383.1| hypothetical protein CICLE_v10018788mg [Citr... 67 2e-09 ref|XP_006443382.1| hypothetical protein CICLE_v10018788mg [Citr... 67 2e-09 ref|XP_006443381.1| hypothetical protein CICLE_v10018788mg [Citr... 67 2e-09 ref|XP_006400370.1| hypothetical protein EUTSA_v10012672mg [Eutr... 67 2e-09 ref|XP_002325409.2| hypothetical protein POPTR_0019s04840g [Popu... 67 2e-09 ref|XP_006846198.1| hypothetical protein AMTR_s00012p00217710 [A... 67 2e-09 ref|XP_006826323.1| hypothetical protein AMTR_s00004p00093740 [A... 67 2e-09 >gb|EXB80292.1| CCR4-NOT transcription complex subunit 3 [Morus notabilis] Length = 956 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006650361.1| PREDICTED: general negative regulator of transcription subunit 3-like isoform X1 [Oryza brachyantha] Length = 854 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006348030.1| PREDICTED: general negative regulator of transcription subunit 3-like isoform X2 [Solanum tuberosum] Length = 854 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006348029.1| PREDICTED: general negative regulator of transcription subunit 3-like isoform X1 [Solanum tuberosum] Length = 856 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006443392.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|568850798|ref|XP_006479084.1| PREDICTED: CCR4-NOT transcription complex subunit 3-like isoform X1 [Citrus sinensis] gi|557545654|gb|ESR56632.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 892 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006443391.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|568850802|ref|XP_006479086.1| PREDICTED: CCR4-NOT transcription complex subunit 3-like isoform X3 [Citrus sinensis] gi|557545653|gb|ESR56631.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 873 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006443390.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|568850800|ref|XP_006479085.1| PREDICTED: CCR4-NOT transcription complex subunit 3-like isoform X2 [Citrus sinensis] gi|557545652|gb|ESR56630.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 885 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006443389.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545651|gb|ESR56629.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 866 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006443388.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545650|gb|ESR56628.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 569 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006443387.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545649|gb|ESR56627.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 671 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006443386.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545648|gb|ESR56626.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 550 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006443385.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545647|gb|ESR56625.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 652 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006443384.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545646|gb|ESR56624.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 576 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006443383.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545645|gb|ESR56623.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 664 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006443382.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545644|gb|ESR56622.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 557 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006443381.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] gi|557545643|gb|ESR56621.1| hypothetical protein CICLE_v10018788mg [Citrus clementina] Length = 645 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006400370.1| hypothetical protein EUTSA_v10012672mg [Eutrema salsugineum] gi|557101460|gb|ESQ41823.1| hypothetical protein EUTSA_v10012672mg [Eutrema salsugineum] Length = 845 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_002325409.2| hypothetical protein POPTR_0019s04840g [Populus trichocarpa] gi|550316806|gb|EEE99790.2| hypothetical protein POPTR_0019s04840g [Populus trichocarpa] Length = 895 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006846198.1| hypothetical protein AMTR_s00012p00217710 [Amborella trichopoda] gi|548848968|gb|ERN07873.1| hypothetical protein AMTR_s00012p00217710 [Amborella trichopoda] Length = 900 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32 >ref|XP_006826323.1| hypothetical protein AMTR_s00004p00093740 [Amborella trichopoda] gi|548830637|gb|ERM93560.1| hypothetical protein AMTR_s00004p00093740 [Amborella trichopoda] Length = 900 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 96 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV Sbjct: 1 MGASRKLQGEIDRVLKKVQEGVDVFDSIWNKV 32