BLASTX nr result
ID: Catharanthus22_contig00010193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00010193 (209 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303999.2| hypothetical protein POPTR_0003s21120g [Popu... 120 2e-25 gb|EOY10575.1| Myb domain protein 5, putative [Theobroma cacao] 120 2e-25 gb|AAY51377.1| PH4 [Petunia x hybrida] 120 2e-25 emb|CBI29955.3| unnamed protein product [Vitis vinifera] 120 2e-25 ref|NP_001268108.1| Myb transcription factor [Vitis vinifera] gi... 120 2e-25 ref|XP_002297634.1| hypothetical protein POPTR_0001s04240g [Popu... 119 3e-25 gb|ESW33457.1| hypothetical protein PHAVU_001G071000g [Phaseolus... 119 4e-25 ref|XP_006593823.1| PREDICTED: transcription repressor MYB5-like... 119 5e-25 ref|XP_006488922.1| PREDICTED: transcription factor MYB34-like [... 119 5e-25 ref|XP_006445608.1| hypothetical protein CICLE_v10015648mg [Citr... 119 5e-25 gb|AGQ46761.1| MYB transcription factor [Malus domestica] 118 7e-25 gb|AAK19611.1|AF336278_1 BNLGHi233 [Gossypium hirsutum] 118 7e-25 gb|ACI23563.1| MYB-like protein 2 [Gossypium barbadense] 118 7e-25 ref|XP_004295005.1| PREDICTED: transcription repressor MYB5-like... 118 9e-25 gb|AFH03061.1| R2R3-MYB transcription factor MYB9 [Epimedium sag... 118 9e-25 gb|ADL36755.1| MYB domain class transcription factor [Malus dome... 117 1e-24 gb|EOY08909.1| Myb domain protein 5 isoform 2, partial [Theobrom... 117 2e-24 gb|EOY08908.1| Myb domain protein 5 isoform 1 [Theobroma cacao] 117 2e-24 ref|XP_002319687.1| predicted protein [Populus trichocarpa] 117 2e-24 ref|NP_001267854.1| MYB5b [Vitis vinifera] gi|61661400|gb|AAX512... 117 2e-24 >ref|XP_002303999.2| hypothetical protein POPTR_0003s21120g [Populus trichocarpa] gi|550343680|gb|EEE78978.2| hypothetical protein POPTR_0003s21120g [Populus trichocarpa] Length = 325 Score = 120 bits (301), Expect = 2e-25 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = +1 Query: 40 KVTPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 K TPCC K+GLKRGPWTPEEDELLANYIK+EGEGRWRTLPKKAGLLRCGKSCRLRW Sbjct: 23 KSTPCCIKVGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKKAGLLRCGKSCRLRW 78 >gb|EOY10575.1| Myb domain protein 5, putative [Theobroma cacao] Length = 305 Score = 120 bits (300), Expect = 2e-25 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = +1 Query: 46 TPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 TPCC+K+G+KRGPWTPEEDELLANYIKREGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 15 TPCCSKVGIKRGPWTPEEDELLANYIKREGEGRWRTLPKRAGLLRCGKSCRLRW 68 >gb|AAY51377.1| PH4 [Petunia x hybrida] Length = 281 Score = 120 bits (300), Expect = 2e-25 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = +1 Query: 40 KVTPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 KVTPCC+K+GLKRGPWTPEEDE+L NYI +EGEGRWRTLPKKAGLLRCGKSCRLRW Sbjct: 13 KVTPCCSKVGLKRGPWTPEEDEILTNYINKEGEGRWRTLPKKAGLLRCGKSCRLRW 68 >emb|CBI29955.3| unnamed protein product [Vitis vinifera] Length = 228 Score = 120 bits (300), Expect = 2e-25 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = +1 Query: 46 TPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 TPCC K+GLKRGPWTPEEDELLANY+KREGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 12 TPCCTKVGLKRGPWTPEEDELLANYVKREGEGRWRTLPKRAGLLRCGKSCRLRW 65 >ref|NP_001268108.1| Myb transcription factor [Vitis vinifera] gi|45593281|gb|AAS68190.1| Myb transcription factor [Vitis vinifera] Length = 320 Score = 120 bits (300), Expect = 2e-25 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = +1 Query: 46 TPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 TPCC K+GLKRGPWTPEEDELLANY+KREGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 12 TPCCTKVGLKRGPWTPEEDELLANYVKREGEGRWRTLPKRAGLLRCGKSCRLRW 65 >ref|XP_002297634.1| hypothetical protein POPTR_0001s04240g [Populus trichocarpa] gi|224151966|ref|XP_002337173.1| predicted protein [Populus trichocarpa] gi|222844892|gb|EEE82439.1| hypothetical protein POPTR_0001s04240g [Populus trichocarpa] Length = 316 Score = 119 bits (299), Expect = 3e-25 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = +1 Query: 40 KVTPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 K TPCC K+GLKRGPWTPEEDELL NYIK+EGEGRWRTLPKKAGLLRCGKSCRLRW Sbjct: 15 KTTPCCIKVGLKRGPWTPEEDELLVNYIKKEGEGRWRTLPKKAGLLRCGKSCRLRW 70 >gb|ESW33457.1| hypothetical protein PHAVU_001G071000g [Phaseolus vulgaris] Length = 363 Score = 119 bits (298), Expect = 4e-25 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = +1 Query: 46 TPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 TPCC K+GLKRGPWTPEEDE+LANYIKREGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 45 TPCCTKVGLKRGPWTPEEDEVLANYIKREGEGRWRTLPKRAGLLRCGKSCRLRW 98 >ref|XP_006593823.1| PREDICTED: transcription repressor MYB5-like [Glycine max] Length = 354 Score = 119 bits (297), Expect = 5e-25 Identities = 49/54 (90%), Positives = 54/54 (100%) Frame = +1 Query: 46 TPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 +PCCNK+GLKRGPWTPEEDE+LANYIK+EGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 33 SPCCNKVGLKRGPWTPEEDEVLANYIKKEGEGRWRTLPKRAGLLRCGKSCRLRW 86 >ref|XP_006488922.1| PREDICTED: transcription factor MYB34-like [Citrus sinensis] Length = 375 Score = 119 bits (297), Expect = 5e-25 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = +1 Query: 40 KVTPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 K TPCC+K+GLKRGPWTPEEDELLANYI +EGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 22 KSTPCCSKVGLKRGPWTPEEDELLANYINKEGEGRWRTLPKRAGLLRCGKSCRLRW 77 >ref|XP_006445608.1| hypothetical protein CICLE_v10015648mg [Citrus clementina] gi|557548219|gb|ESR58848.1| hypothetical protein CICLE_v10015648mg [Citrus clementina] Length = 374 Score = 119 bits (297), Expect = 5e-25 Identities = 50/56 (89%), Positives = 54/56 (96%) Frame = +1 Query: 40 KVTPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 K TPCC+K+GLKRGPWTPEEDELLANYI +EGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 21 KSTPCCSKVGLKRGPWTPEEDELLANYINKEGEGRWRTLPKRAGLLRCGKSCRLRW 76 >gb|AGQ46761.1| MYB transcription factor [Malus domestica] Length = 364 Score = 118 bits (296), Expect = 7e-25 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = +1 Query: 46 TPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 TPCC K+GLKRGPWTPEEDELLANYIK+EGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 40 TPCCAKVGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKRAGLLRCGKSCRLRW 93 >gb|AAK19611.1|AF336278_1 BNLGHi233 [Gossypium hirsutum] Length = 247 Score = 118 bits (296), Expect = 7e-25 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = +1 Query: 40 KVTPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 K TPCC+K+GLKRGPWTPEEDELL+NYI +EGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 13 KTTPCCSKVGLKRGPWTPEEDELLSNYINKEGEGRWRTLPKRAGLLRCGKSCRLRW 68 >gb|ACI23563.1| MYB-like protein 2 [Gossypium barbadense] Length = 248 Score = 118 bits (296), Expect = 7e-25 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = +1 Query: 40 KVTPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 K TPCC+K+GLKRGPWTPEEDELL+NYI +EGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 13 KTTPCCSKVGLKRGPWTPEEDELLSNYINKEGEGRWRTLPKRAGLLRCGKSCRLRW 68 >ref|XP_004295005.1| PREDICTED: transcription repressor MYB5-like [Fragaria vesca subsp. vesca] Length = 346 Score = 118 bits (295), Expect = 9e-25 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = +1 Query: 46 TPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 TPCC K+GLKRGPWTPEEDELLANYIK+EGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 31 TPCCVKVGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKRAGLLRCGKSCRLRW 84 >gb|AFH03061.1| R2R3-MYB transcription factor MYB9 [Epimedium sagittatum] Length = 290 Score = 118 bits (295), Expect = 9e-25 Identities = 51/56 (91%), Positives = 52/56 (92%) Frame = +1 Query: 40 KVTPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 K TPCC KIGLKRGPWTPEEDELL +YIKREGEGRWR LPKKAGLLRCGKSCRLRW Sbjct: 20 KTTPCCTKIGLKRGPWTPEEDELLCDYIKREGEGRWRILPKKAGLLRCGKSCRLRW 75 >gb|ADL36755.1| MYB domain class transcription factor [Malus domestica] Length = 357 Score = 117 bits (294), Expect = 1e-24 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = +1 Query: 46 TPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 TPCC K+GLKRGPWTPEEDELLANYIK+EGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 19 TPCCVKVGLKRGPWTPEEDELLANYIKKEGEGRWRTLPKQAGLLRCGKSCRLRW 72 >gb|EOY08909.1| Myb domain protein 5 isoform 2, partial [Theobroma cacao] Length = 311 Score = 117 bits (293), Expect = 2e-24 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = +1 Query: 46 TPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 TPCC K+GLKRGPWTPEEDELLA+YIKREGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 27 TPCCIKVGLKRGPWTPEEDELLASYIKREGEGRWRTLPKRAGLLRCGKSCRLRW 80 >gb|EOY08908.1| Myb domain protein 5 isoform 1 [Theobroma cacao] Length = 328 Score = 117 bits (293), Expect = 2e-24 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = +1 Query: 46 TPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 TPCC K+GLKRGPWTPEEDELLA+YIKREGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 27 TPCCIKVGLKRGPWTPEEDELLASYIKREGEGRWRTLPKRAGLLRCGKSCRLRW 80 >ref|XP_002319687.1| predicted protein [Populus trichocarpa] Length = 308 Score = 117 bits (293), Expect = 2e-24 Identities = 48/54 (88%), Positives = 54/54 (100%) Frame = +1 Query: 46 TPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 TPCC+K+G+KRGPWTPEEDELLANYIK++GEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 17 TPCCSKVGIKRGPWTPEEDELLANYIKKDGEGRWRTLPKQAGLLRCGKSCRLRW 70 >ref|NP_001267854.1| MYB5b [Vitis vinifera] gi|61661400|gb|AAX51291.1| MYB5b [Vitis vinifera] Length = 311 Score = 117 bits (292), Expect = 2e-24 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = +1 Query: 46 TPCCNKIGLKRGPWTPEEDELLANYIKREGEGRWRTLPKKAGLLRCGKSCRLRW 207 TPCC K+GLKRGPWTPEEDE+LANYIK+EGEGRWRTLPK+AGLLRCGKSCRLRW Sbjct: 17 TPCCIKVGLKRGPWTPEEDEVLANYIKKEGEGRWRTLPKRAGLLRCGKSCRLRW 70