BLASTX nr result
ID: Catharanthus22_contig00010008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00010008 (583 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAO49749.1| nuclear pore complex protein Seh1b [Nicotiana be... 56 8e-06 >dbj|BAO49749.1| nuclear pore complex protein Seh1b [Nicotiana benthamiana] Length = 360 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +2 Query: 2 WNPQRGEISQSSFVLGFNSDIPQLNSSKVF 91 WNP +GEI QSSFVLGFNSD+PQ+NSSKV+ Sbjct: 160 WNPLKGEIQQSSFVLGFNSDMPQMNSSKVW 189