BLASTX nr result
ID: Catharanthus22_contig00009988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00009988 (263 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300644.1| dolichyl-phosphate beta-D-mannosyltransferas... 64 2e-08 ref|XP_003597358.1| Dolichol-phosphate mannosyltransferase [Medi... 63 5e-08 gb|EXB56325.1| hypothetical protein L484_024867 [Morus notabilis] 61 1e-07 ref|NP_564118.1| dolichol-phosphate mannosyltransferase [Arabido... 61 2e-07 ref|XP_006473777.1| PREDICTED: dolichol-phosphate mannosyltransf... 61 2e-07 ref|XP_006435349.1| hypothetical protein CICLE_v10003501mg, part... 61 2e-07 ref|XP_006416383.1| hypothetical protein EUTSA_v10008599mg [Eutr... 61 2e-07 ref|XP_004238425.1| PREDICTED: dolichol-phosphate mannosyltransf... 61 2e-07 gb|EOY15243.1| Nucleotide-diphospho-sugar transferases superfami... 60 2e-07 ref|XP_004309507.1| PREDICTED: dolichol-phosphate mannosyltransf... 60 3e-07 ref|XP_004505127.1| PREDICTED: dolichol-phosphate mannosyltransf... 60 4e-07 ref|XP_006303309.1| hypothetical protein CARUB_v10010118mg [Caps... 60 4e-07 ref|XP_006303308.1| hypothetical protein CARUB_v10010118mg [Caps... 60 4e-07 ref|XP_002466177.1| hypothetical protein SORBIDRAFT_01g002910 [S... 60 4e-07 ref|XP_002510671.1| dolichol-phosphate mannosyltransferase, puta... 60 4e-07 ref|XP_002307788.1| dolichyl-phosphate beta-D-mannosyltransferas... 60 4e-07 ref|NP_001140901.1| uncharacterized protein LOC100272978 [Zea ma... 60 4e-07 ref|XP_006841444.1| hypothetical protein AMTR_s00003p00074710 [A... 59 5e-07 gb|EMJ10684.1| hypothetical protein PRUPE_ppa010139mg [Prunus pe... 59 5e-07 ref|XP_004145537.1| PREDICTED: dolichol-phosphate mannosyltransf... 59 5e-07 >ref|XP_002300644.1| dolichyl-phosphate beta-D-mannosyltransferase family protein [Populus trichocarpa] gi|222842370|gb|EEE79917.1| dolichyl-phosphate beta-D-mannosyltransferase family protein [Populus trichocarpa] Length = 240 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 162 EDQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 E +KKNKYSII+PTYNERLN+ALIVYL+FKHL D Sbjct: 2 EKEKKNKYSIIVPTYNERLNIALIVYLIFKHLRD 35 >ref|XP_003597358.1| Dolichol-phosphate mannosyltransferase [Medicago truncatula] gi|355486406|gb|AES67609.1| Dolichol-phosphate mannosyltransferase [Medicago truncatula] Length = 271 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +3 Query: 165 DQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 +QKKNKYSII+P YNERLN++LI+YL+FKHLPD Sbjct: 34 NQKKNKYSIIVPIYNERLNISLILYLIFKHLPD 66 >gb|EXB56325.1| hypothetical protein L484_024867 [Morus notabilis] Length = 244 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 165 DQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 D+ KNKYSII+PTYNERLN+AL+VYLVFKHL D Sbjct: 7 DKGKNKYSIIVPTYNERLNIALLVYLVFKHLRD 39 >ref|NP_564118.1| dolichol-phosphate mannosyltransferase [Arabidopsis thaliana] gi|8886954|gb|AAF80640.1|AC069251_33 F2D10.6 [Arabidopsis thaliana] gi|29028862|gb|AAO64810.1| At1g20575 [Arabidopsis thaliana] gi|51969260|dbj|BAD43322.1| hypothetical protein [Arabidopsis thaliana] gi|110743122|dbj|BAE99453.1| hypothetical protein [Arabidopsis thaliana] gi|332191868|gb|AEE29989.1| dolichol-phosphate mannosyltransferase [Arabidopsis thaliana] Length = 246 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +3 Query: 159 TEDQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 T+ +KK KYSIIIPTYNERLN+A+IVYL+FKHL D Sbjct: 7 TKGEKKYKYSIIIPTYNERLNIAIIVYLIFKHLRD 41 >ref|XP_006473777.1| PREDICTED: dolichol-phosphate mannosyltransferase-like isoform X1 [Citrus sinensis] Length = 242 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 165 DQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 ++ KNKYSIIIPTYNERLN+ALIVYL+FKHL D Sbjct: 5 NKNKNKYSIIIPTYNERLNIALIVYLIFKHLRD 37 >ref|XP_006435349.1| hypothetical protein CICLE_v10003501mg, partial [Citrus clementina] gi|557537471|gb|ESR48589.1| hypothetical protein CICLE_v10003501mg, partial [Citrus clementina] Length = 245 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 165 DQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 ++ KNKYSIIIPTYNERLN+ALIVYL+FKHL D Sbjct: 7 NKNKNKYSIIIPTYNERLNIALIVYLIFKHLRD 39 >ref|XP_006416383.1| hypothetical protein EUTSA_v10008599mg [Eutrema salsugineum] gi|557094154|gb|ESQ34736.1| hypothetical protein EUTSA_v10008599mg [Eutrema salsugineum] Length = 246 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 153 KMTEDQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 K T+ KK KYSII+PTYNERLN+ALIVYL+FKHL D Sbjct: 5 KETKGGKKYKYSIIVPTYNERLNIALIVYLIFKHLRD 41 >ref|XP_004238425.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Solanum lycopersicum] gi|565350338|ref|XP_006342127.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Solanum tuberosum] Length = 238 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 171 KKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 +KNKYSIIIPTYNERLN+ALI+YLVFKHL D Sbjct: 3 EKNKYSIIIPTYNERLNIALIIYLVFKHLTD 33 >gb|EOY15243.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma cacao] Length = 241 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +3 Query: 156 MTEDQKKNKYSIIIPTYNERLNVALIVYLVFKHL 257 M + ++KNKYS+I+PTYNERLN+ALIVYL+FKHL Sbjct: 1 MEQKKEKNKYSVIVPTYNERLNIALIVYLIFKHL 34 >ref|XP_004309507.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Fragaria vesca subsp. vesca] Length = 239 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +3 Query: 165 DQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 ++ KNKYSII+PTYNERLN+AL+VYLVFKHL D Sbjct: 2 EKTKNKYSIIVPTYNERLNIALLVYLVFKHLRD 34 >ref|XP_004505127.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Cicer arietinum] Length = 242 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = +3 Query: 162 EDQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 + ++KNKYSII+PTYNERLN++LI+YL+FKHL D Sbjct: 4 QQKQKNKYSIIVPTYNERLNISLIIYLIFKHLRD 37 >ref|XP_006303309.1| hypothetical protein CARUB_v10010118mg [Capsella rubella] gi|482572020|gb|EOA36207.1| hypothetical protein CARUB_v10010118mg [Capsella rubella] Length = 246 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 153 KMTEDQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 K +KK KYSIIIPTYNERLN+A+IVYL+FKHL D Sbjct: 5 KENNGEKKYKYSIIIPTYNERLNIAIIVYLIFKHLRD 41 >ref|XP_006303308.1| hypothetical protein CARUB_v10010118mg [Capsella rubella] gi|482572019|gb|EOA36206.1| hypothetical protein CARUB_v10010118mg [Capsella rubella] Length = 174 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +3 Query: 153 KMTEDQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 K +KK KYSIIIPTYNERLN+A+IVYL+FKHL D Sbjct: 5 KENNGEKKYKYSIIIPTYNERLNIAIIVYLIFKHLRD 41 >ref|XP_002466177.1| hypothetical protein SORBIDRAFT_01g002910 [Sorghum bicolor] gi|241920031|gb|EER93175.1| hypothetical protein SORBIDRAFT_01g002910 [Sorghum bicolor] Length = 242 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 171 KKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 +K YSII+PTYNERLNVALIVYL+FKHLPD Sbjct: 7 RKRAYSIIVPTYNERLNVALIVYLIFKHLPD 37 >ref|XP_002510671.1| dolichol-phosphate mannosyltransferase, putative [Ricinus communis] gi|223551372|gb|EEF52858.1| dolichol-phosphate mannosyltransferase, putative [Ricinus communis] Length = 238 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 171 KKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 +KNKYS+IIPTYNERLN+ALIVYL+FKHL D Sbjct: 3 EKNKYSLIIPTYNERLNIALIVYLIFKHLRD 33 >ref|XP_002307788.1| dolichyl-phosphate beta-D-mannosyltransferase family protein [Populus trichocarpa] gi|222857237|gb|EEE94784.1| dolichyl-phosphate beta-D-mannosyltransferase family protein [Populus trichocarpa] Length = 238 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 168 QKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 +K N+YSII+PTYNERLN+ALIVYL+FKHL D Sbjct: 2 EKNNRYSIIVPTYNERLNIALIVYLIFKHLQD 33 >ref|NP_001140901.1| uncharacterized protein LOC100272978 [Zea mays] gi|194701668|gb|ACF84918.1| unknown [Zea mays] gi|223972949|gb|ACN30662.1| unknown [Zea mays] Length = 242 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 171 KKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 +K YSII+PTYNERLNVALIVYL+FKHLPD Sbjct: 7 RKRAYSIIVPTYNERLNVALIVYLIFKHLPD 37 >ref|XP_006841444.1| hypothetical protein AMTR_s00003p00074710 [Amborella trichopoda] gi|548843465|gb|ERN03119.1| hypothetical protein AMTR_s00003p00074710 [Amborella trichopoda] Length = 246 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = +3 Query: 147 RSKMTEDQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 R + E+ K KYSI++PTYNERLN+ALIVYL+FKH+ D Sbjct: 3 RGEEMENDNKKKYSILVPTYNERLNIALIVYLIFKHIRD 41 >gb|EMJ10684.1| hypothetical protein PRUPE_ppa010139mg [Prunus persica] Length = 262 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 171 KKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 +KNKYSII+PTYNERLN+AL+VYL+FKHL D Sbjct: 2 EKNKYSIIVPTYNERLNIALLVYLIFKHLRD 32 >ref|XP_004145537.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Cucumis sativus] gi|449512678|ref|XP_004164113.1| PREDICTED: dolichol-phosphate mannosyltransferase-like [Cucumis sativus] Length = 242 Score = 59.3 bits (142), Expect = 5e-07 Identities = 22/33 (66%), Positives = 33/33 (100%) Frame = +3 Query: 165 DQKKNKYSIIIPTYNERLNVALIVYLVFKHLPD 263 +++++KYS+I+PTYNER+N+AL+VYL+FKHLPD Sbjct: 5 EKERDKYSLIVPTYNERINIALLVYLIFKHLPD 37