BLASTX nr result
ID: Catharanthus22_contig00009760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00009760 (245 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006387952.1| hypothetical protein POPTR_0458s00200g [Popu... 56 6e-06 ref|XP_006387951.1| hypothetical protein POPTR_0458s00200g [Popu... 56 6e-06 ref|XP_002337756.1| cytochrome P450 [Populus trichocarpa] 56 6e-06 gb|AED99874.1| cytochrome P450 [Panax notoginseng] 55 1e-05 gb|ADZ48682.1| cytochrome P450 [Catharanthus roseus] 55 1e-05 >ref|XP_006387952.1| hypothetical protein POPTR_0458s00200g [Populus trichocarpa] gi|550309011|gb|ERP46866.1| hypothetical protein POPTR_0458s00200g [Populus trichocarpa] Length = 498 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 1 FDWKRLGPEMVDLQEKGGLTIHKAKPLKALCRPRQDMI 114 F+W+++G +MVD+ E G TI KAKPLK +CRPR DM+ Sbjct: 455 FEWQKIGDKMVDMTEASGFTIPKAKPLKVICRPRPDML 492 >ref|XP_006387951.1| hypothetical protein POPTR_0458s00200g [Populus trichocarpa] gi|550309010|gb|ERP46865.1| hypothetical protein POPTR_0458s00200g [Populus trichocarpa] Length = 360 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 1 FDWKRLGPEMVDLQEKGGLTIHKAKPLKALCRPRQDMI 114 F+W+++G +MVD+ E G TI KAKPLK +CRPR DM+ Sbjct: 317 FEWQKIGDKMVDMTEASGFTIPKAKPLKVICRPRPDML 354 >ref|XP_002337756.1| cytochrome P450 [Populus trichocarpa] Length = 191 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/38 (57%), Positives = 30/38 (78%) Frame = +1 Query: 1 FDWKRLGPEMVDLQEKGGLTIHKAKPLKALCRPRQDMI 114 F+W+++G +MVD+ E G TI KAKPLK +CRPR DM+ Sbjct: 150 FEWQKIGDKMVDMTEASGFTIPKAKPLKVICRPRPDML 187 >gb|AED99874.1| cytochrome P450 [Panax notoginseng] Length = 509 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = +1 Query: 1 FDWKRLGPEMVDLQEKGGLTIHKAKPLKALCRPRQDMI 114 FDW R+G EMVD+ E+ GLT KA+PL A+CRPR M+ Sbjct: 463 FDWARVGKEMVDMTERSGLTAPKAQPLMAVCRPRASMV 500 >gb|ADZ48682.1| cytochrome P450 [Catharanthus roseus] Length = 503 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 1 FDWKRLGPEMVDLQEKGGLTIHKAKPLKALCRP 99 FDWKRLGPE+VD+QEK GLT+H+ KPL A +P Sbjct: 461 FDWKRLGPELVDMQEKPGLTMHRDKPLVAFYKP 493