BLASTX nr result
ID: Catharanthus22_contig00009547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00009547 (2470 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234789.1| inositol-1,4,5-triphosphate-5-phosphatase [S... 60 5e-06 >ref|NP_001234789.1| inositol-1,4,5-triphosphate-5-phosphatase [Solanum lycopersicum] gi|157863708|gb|ABV90875.1| inositol-1,4,5-triphosphate-5-phosphatase [Solanum lycopersicum] Length = 630 Score = 60.1 bits (144), Expect = 5e-06 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 4/69 (5%) Frame = +1 Query: 1822 FPVLVPLNDGNVLGAENRRQIPK*EA---SHYSKDFESETRIRTHRV-PHPLLKTSVAAD 1989 F +VPLN GNVLGAENRR +PK EA ++ E ET+++++ P P+L+TS A D Sbjct: 143 FQEVVPLNAGNVLGAENRRPVPKWEAIIRRTLNRTEEPETKLKSYSAPPSPVLRTSSADD 202 Query: 1990 FLADVTETP 2016 +ADV + P Sbjct: 203 IIADVVDAP 211