BLASTX nr result
ID: Catharanthus22_contig00009422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00009422 (881 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] 55 1e-12 >emb|CAN71712.1| hypothetical protein VITISV_013459 [Vitis vinifera] Length = 115 Score = 55.5 bits (132), Expect(2) = 1e-12 Identities = 26/63 (41%), Positives = 40/63 (63%) Frame = +3 Query: 339 MGFDETVSFVEEKLQDLWLGMEDFWRQFLNWFDKVFPPETRGEKLHQWLAMALPFLXXXX 518 MG + + FV EKL++L + +E+F ++ DKVF P++RGEKL W+ + PFL Sbjct: 1 MGAESVMKFVVEKLKELLVLLENFGGYLVDEVDKVFAPDSRGEKLRHWIQVGAPFLILGL 60 Query: 519 VLL 527 VL+ Sbjct: 61 VLV 63 Score = 45.1 bits (105), Expect(2) = 1e-12 Identities = 20/34 (58%), Positives = 26/34 (76%) Frame = +1 Query: 550 RRVRMMKAPGRNCRMPRHVFEANPKSYFSNLRSN 651 R V+MMKAPGR+ RM R FE+NP+ YF LR++ Sbjct: 77 RGVKMMKAPGRDYRMARPPFESNPRGYFRGLRAD 110