BLASTX nr result
ID: Catharanthus22_contig00009345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00009345 (1342 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600615.1| hypothetical protein MTR_3g064280 [Medicago ... 63 2e-07 ref|XP_003600614.1| Zinc finger CCCH domain-containing protein [... 63 3e-07 gb|EMJ26132.1| hypothetical protein PRUPE_ppa021594mg [Prunus pe... 61 1e-06 emb|CBI29667.3| unnamed protein product [Vitis vinifera] 59 5e-06 emb|CBI27724.3| unnamed protein product [Vitis vinifera] 59 5e-06 ref|XP_003600612.1| Zinc finger CCCH domain-containing protein [... 58 8e-06 >ref|XP_003600615.1| hypothetical protein MTR_3g064280 [Medicago truncatula] gi|355489663|gb|AES70866.1| hypothetical protein MTR_3g064280 [Medicago truncatula] Length = 814 Score = 63.2 bits (152), Expect = 2e-07 Identities = 33/61 (54%), Positives = 38/61 (62%) Frame = +3 Query: 3 TKHWIPREISLLQRRIDRANEKGWRREYPFHLPNYALW*LDYLCVTGKYIFGQALDSSKL 182 TKHWI REI LL+ RIDRANEKGWRREYPF + YL + K A + S+L Sbjct: 514 TKHWISREIELLRNRIDRANEKGWRREYPFMI---------YLYMDQKQKLESAAEQSRL 564 Query: 183 L 185 L Sbjct: 565 L 565 >ref|XP_003600614.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355489662|gb|AES70865.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Length = 964 Score = 62.8 bits (151), Expect = 3e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 3 TKHWIPREISLLQRRIDRANEKGWRREYPFHL 98 TKHWI REI LL+ RIDRANEKGWRREYPF++ Sbjct: 519 TKHWISREIELLRNRIDRANEKGWRREYPFYM 550 >gb|EMJ26132.1| hypothetical protein PRUPE_ppa021594mg [Prunus persica] Length = 527 Score = 60.8 bits (146), Expect = 1e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 6 KHWIPREISLLQRRIDRANEKGWRREYPF 92 KHWI RE+SLLQ+RID+ANEKGWRREYPF Sbjct: 488 KHWIGRELSLLQKRIDKANEKGWRREYPF 516 >emb|CBI29667.3| unnamed protein product [Vitis vinifera] Length = 819 Score = 58.9 bits (141), Expect = 5e-06 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 3 TKHWIPREISLLQRRIDRANEKGWRREYPFHL 98 TKHWI +EISLLQ IDRANEKGWRREYP L Sbjct: 482 TKHWIEKEISLLQNLIDRANEKGWRREYPLML 513 >emb|CBI27724.3| unnamed protein product [Vitis vinifera] Length = 63 Score = 58.9 bits (141), Expect = 5e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 3 TKHWIPREISLLQRRIDRANEKGWRREYPFHL 98 TKHWI RE+ LLQ IDRANEKGWR+EYPF L Sbjct: 26 TKHWIARELDLLQNLIDRANEKGWRKEYPFTL 57 >ref|XP_003600612.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355489660|gb|AES70863.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Length = 862 Score = 58.2 bits (139), Expect = 8e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +3 Query: 6 KHWIPREISLLQRRIDRANEKGWRREYPFHL 98 KHWI RE LL+ RIDRANEKGWRREYPF++ Sbjct: 559 KHWISRERELLRNRIDRANEKGWRREYPFYM 589