BLASTX nr result
ID: Catharanthus22_contig00009228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00009228 (571 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicot... 62 1e-07 >ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653955|ref|YP_004891682.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11873|emb|CAA77388.1| hypothetical protein [Nicotiana tabacum] gi|1223685|emb|CAA77405.1| hypothetical protein [Nicotiana tabacum] gi|77799611|dbj|BAE46700.1| hypothetical protein [Nicotiana sylvestris] gi|77799641|dbj|BAE46730.1| hypothetical protein [Nicotiana sylvestris] gi|80750973|dbj|BAE48049.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751003|dbj|BAE48079.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453933|gb|AEO95591.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453981|gb|AEO95639.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454044|gb|AEO95701.1| hypothetical protein [synthetic construct] gi|347454090|gb|AEO95747.1| hypothetical protein [synthetic construct] gi|225244|prf||1211235CC ORF 115 Length = 115 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 536 KMPAHNPKDKLH*IIQGLATYPFSDFGTRRSQHGYFLV 423 KMPA NP DK+H I+QGLATYPFSDFGT RSQ+G + V Sbjct: 75 KMPARNPADKVHYIVQGLATYPFSDFGTGRSQNGDYRV 112