BLASTX nr result
ID: Catharanthus22_contig00008861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00008861 (697 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004306994.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 62 2e-07 gb|EMJ03678.1| hypothetical protein PRUPE_ppa010439mg [Prunus pe... 62 2e-07 ref|XP_002274957.1| PREDICTED: FKBP-type peptidyl-prolyl cis-tra... 62 2e-07 ref|XP_002338948.1| predicted protein [Populus trichocarpa] 62 2e-07 gb|EPS68814.1| hypothetical protein M569_05956, partial [Genlise... 61 3e-07 ref|XP_006657711.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 4e-07 ref|XP_006359593.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 4e-07 gb|EOX96444.1| FKBP-like peptidyl-prolyl cis-trans isomerase fam... 61 4e-07 gb|EOX96443.1| FKBP-like peptidyl-prolyl cis-trans isomerase fam... 61 4e-07 ref|XP_004248526.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 4e-07 ref|NP_001059674.1| Os07g0490400 [Oryza sativa Japonica Group] g... 61 4e-07 ref|NP_001236089.1| uncharacterized protein LOC100305486 [Glycin... 61 4e-07 ref|XP_002460715.1| hypothetical protein SORBIDRAFT_02g033640 [S... 61 4e-07 gb|EEC82060.1| hypothetical protein OsI_26047 [Oryza sativa Indi... 61 4e-07 ref|NP_001151655.1| FK506 binding protein [Zea mays] gi|19564843... 61 4e-07 ref|XP_006375118.1| hypothetical protein POPTR_0014s04510g [Popu... 60 5e-07 ref|XP_006375116.1| hypothetical protein POPTR_0014s04510g [Popu... 60 5e-07 ref|XP_006375114.1| hypothetical protein POPTR_0014s04510g [Popu... 60 5e-07 ref|XP_002327057.1| predicted protein [Populus trichocarpa] gi|5... 60 5e-07 gb|EMT21021.1| FKBP-type peptidyl-prolyl cis-trans isomerase 6, ... 60 7e-07 >ref|XP_004306994.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 250 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDMKPGGKRRIIIPPELGPPV + SS Sbjct: 185 GFEEGIRDMKPGGKRRIIIPPELGPPVGPSTFFSS 219 >gb|EMJ03678.1| hypothetical protein PRUPE_ppa010439mg [Prunus persica] Length = 249 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDMKPGGKRRIIIPPELGPPV + SS Sbjct: 184 GFEEGIRDMKPGGKRRIIIPPELGPPVGPSTFFSS 218 >ref|XP_002274957.1| PREDICTED: FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic [Vitis vinifera] gi|297734593|emb|CBI16644.3| unnamed protein product [Vitis vinifera] Length = 258 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDMKPGGKRRIIIPPELGPPV + SS Sbjct: 194 GFEEGIRDMKPGGKRRIIIPPELGPPVGPSTFFSS 228 >ref|XP_002338948.1| predicted protein [Populus trichocarpa] Length = 122 Score = 62.0 bits (149), Expect = 2e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSL 100 GFEEGIRDM+PGGKRRIIIPPELGPPVS + L Sbjct: 69 GFEEGIRDMRPGGKRRIIIPPELGPPVSFSNCL 101 >gb|EPS68814.1| hypothetical protein M569_05956, partial [Genlisea aurea] Length = 196 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDMKPGGKRRI++PPELGPPV + SS Sbjct: 132 GFEEGIRDMKPGGKRRIVVPPELGPPVGPSTFFSS 166 >ref|XP_006657711.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like [Oryza brachyantha] Length = 261 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPV 82 GFEEGIRDMKPGGKRRIIIPPELGPPV Sbjct: 197 GFEEGIRDMKPGGKRRIIIPPELGPPV 223 >ref|XP_006359593.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like [Solanum tuberosum] Length = 253 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDM+PGGKRRIIIPPELGPPV + SS Sbjct: 189 GFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSS 223 >gb|EOX96444.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Theobroma cacao] Length = 253 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDM+PGGKRRIIIPPELGPPV + SS Sbjct: 189 GFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSS 223 >gb|EOX96443.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Theobroma cacao] Length = 292 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDM+PGGKRRIIIPPELGPPV + SS Sbjct: 228 GFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSS 262 >ref|XP_004248526.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic-like [Solanum lycopersicum] Length = 257 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDM+PGGKRRIIIPPELGPPV + SS Sbjct: 193 GFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSS 227 >ref|NP_001059674.1| Os07g0490400 [Oryza sativa Japonica Group] gi|33146997|dbj|BAC80069.1| putative FKBP-type peptidyl-prolyl cis-trans isomerase; protein [Oryza sativa Japonica Group] gi|113611210|dbj|BAF21588.1| Os07g0490400 [Oryza sativa Japonica Group] Length = 258 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPV 82 GFEEGIRDMKPGGKRRIIIPPELGPPV Sbjct: 194 GFEEGIRDMKPGGKRRIIIPPELGPPV 220 >ref|NP_001236089.1| uncharacterized protein LOC100305486 [Glycine max] gi|255625657|gb|ACU13173.1| unknown [Glycine max] Length = 248 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDM+PGGKRRIIIPPELGPPV + SS Sbjct: 184 GFEEGIRDMRPGGKRRIIIPPELGPPVGPSTFFSS 218 >ref|XP_002460715.1| hypothetical protein SORBIDRAFT_02g033640 [Sorghum bicolor] gi|241924092|gb|EER97236.1| hypothetical protein SORBIDRAFT_02g033640 [Sorghum bicolor] Length = 245 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPV 82 GFEEGIRDMKPGGKRRIIIPPELGPPV Sbjct: 181 GFEEGIRDMKPGGKRRIIIPPELGPPV 207 >gb|EEC82060.1| hypothetical protein OsI_26047 [Oryza sativa Indica Group] gi|222637062|gb|EEE67194.1| hypothetical protein OsJ_24296 [Oryza sativa Japonica Group] Length = 243 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPV 82 GFEEGIRDMKPGGKRRIIIPPELGPPV Sbjct: 179 GFEEGIRDMKPGGKRRIIIPPELGPPV 205 >ref|NP_001151655.1| FK506 binding protein [Zea mays] gi|195648438|gb|ACG43687.1| FK506 binding protein [Zea mays] gi|224035517|gb|ACN36834.1| unknown [Zea mays] gi|414886718|tpg|DAA62732.1| TPA: putative FKBP-type peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 249 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPV 82 GFEEGIRDMKPGGKRRIIIPPELGPPV Sbjct: 185 GFEEGIRDMKPGGKRRIIIPPELGPPV 211 >ref|XP_006375118.1| hypothetical protein POPTR_0014s04510g [Populus trichocarpa] gi|550323434|gb|ERP52915.1| hypothetical protein POPTR_0014s04510g [Populus trichocarpa] Length = 258 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDM+PGGKRRII+PPELGPPV + SS Sbjct: 194 GFEEGIRDMRPGGKRRIIVPPELGPPVGPSTFFSS 228 >ref|XP_006375116.1| hypothetical protein POPTR_0014s04510g [Populus trichocarpa] gi|550323432|gb|ERP52913.1| hypothetical protein POPTR_0014s04510g [Populus trichocarpa] Length = 214 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDM+PGGKRRII+PPELGPPV + SS Sbjct: 150 GFEEGIRDMRPGGKRRIIVPPELGPPVGPSTFFSS 184 >ref|XP_006375114.1| hypothetical protein POPTR_0014s04510g [Populus trichocarpa] gi|550323430|gb|ERP52911.1| hypothetical protein POPTR_0014s04510g [Populus trichocarpa] Length = 186 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDM+PGGKRRII+PPELGPPV + SS Sbjct: 122 GFEEGIRDMRPGGKRRIIVPPELGPPVGPSTFFSS 156 >ref|XP_002327057.1| predicted protein [Populus trichocarpa] gi|566202487|ref|XP_006375115.1| immunophilin family protein [Populus trichocarpa] gi|550323431|gb|ERP52912.1| immunophilin family protein [Populus trichocarpa] Length = 210 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPVSITMSLSS 106 GFEEGIRDM+PGGKRRII+PPELGPPV + SS Sbjct: 146 GFEEGIRDMRPGGKRRIIVPPELGPPVGPSTFFSS 180 >gb|EMT21021.1| FKBP-type peptidyl-prolyl cis-trans isomerase 6, chloroplastic [Aegilops tauschii] Length = 235 Score = 60.1 bits (144), Expect = 7e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 GFEEGIRDMKPGGKRRIIIPPELGPPV 82 GFEEGIRDMKPGGKRR+IIPPELGPPV Sbjct: 171 GFEEGIRDMKPGGKRRLIIPPELGPPV 197