BLASTX nr result
ID: Catharanthus22_contig00008533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus22_contig00008533 (297 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAO49724.1| nuclear pore complex protein Nup35a [Nicotiana b... 57 3e-06 >dbj|BAO49724.1| nuclear pore complex protein Nup35a [Nicotiana benthamiana] Length = 335 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 PYPQYIQNGSSGNLKSAGTVAAPAKSVVSKIVDLMFGV 116 P P Y+QNGS+ +S+G+VA PAKSVVSKIVDLMFGV Sbjct: 298 PRPHYLQNGSNSAKQSSGSVATPAKSVVSKIVDLMFGV 335